Btab013149.1
Basic Information
- Insect
- Bemisia tabaci
- Gene Symbol
- -
- Assembly
- GCA_903994105.1
- Location
- NW:2510558-2518738[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 3 5.6e-08 6.3e-05 22.6 0.2 24 46 3 25 1 31 0.90 2 3 0.0021 2.3 8.0 0.3 26 45 50 69 36 73 0.88 3 3 0.015 16 5.3 0.1 26 48 76 98 69 102 0.88
Sequence Information
- Coding Sequence
- ATGAGGCCTTTTGTTTGTCCAATTTGTAATGCGGTTTACAAGCACAGTCGCAACCTAACCTCCCACATGAAAGTCCACACTGGAGAAACTGGATGCCCTTACTGCAGAAAGAGATTCTCCAACAAGGGCTCGGCGGGAGAGGGCTTCCCGTGTCACATCTGCGGTAGCGTCTACCGACACCGGACGAACCTGTACAGCCACCTGCGGGCCCACAACGGCTCCACCTACTGCTCCATCTGCGACAAGTCCTTCTCCCTCGTCGGCAACTACAAACGACACATGAGTCTCGTTCACACGCCCCAGCGCAAGGACACCTGA
- Protein Sequence
- MRPFVCPICNAVYKHSRNLTSHMKVHTGETGCPYCRKRFSNKGSAGEGFPCHICGSVYRHRTNLYSHLRAHNGSTYCSICDKSFSLVGNYKRHMSLVHTPQRKDT
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00202026;
- 90% Identity
- iTF_00202026;
- 80% Identity
- iTF_00202026;