Btab007605.1
Basic Information
- Insect
- Bemisia tabaci
- Gene Symbol
- -
- Assembly
- GCA_903994105.1
- Location
- NW:9-680[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 6 0.012 13 5.6 0.0 21 44 6 29 2 33 0.87 2 6 0.00017 0.19 11.5 0.1 21 44 34 57 26 61 0.88 3 6 7.8e-05 0.089 12.5 0.1 21 44 62 85 57 89 0.90 4 6 0.01 11 5.8 0.0 21 45 90 114 86 121 0.84 5 6 0.009 10 5.9 0.2 21 45 118 142 114 145 0.90 6 6 0.0015 1.7 8.4 0.2 21 44 146 169 142 173 0.90
Sequence Information
- Coding Sequence
- ATGCGAAAACAtaccggtgaaaaaccattcactTGCAGCCATTGCTCGGCTTGTTTCGCTGGAAAAGGTGATTTAAAACAACACATGCGAACACATActggtgaaaaaccattcacttgcagccattgctcggcttgtttcgctggaaaaggaaatttaaaacgCCACATGCGAAAACATActggtgaaaaaccattcacttgcagccattgctcggcttgtttcgctagaaaaggaaatttaaaacgCCACATGCGAAAACATACCGGTGAAGAACCATTCACTTGTAGCCATTGCTCGGCTTGTTTCGCTGGAAAAGGTGATTTAAAACAACACATGCGAacacatactggtgagaaaccattcagatGCAGCCATTGCTCGGCTTGTTTCGCCCAGAAAGGACATTTAAATAAGCACTTGCGAACACATACCGATGAGAAACCACTCAGATGCAGCCAGTGCGCGGCCTGTTTTGCCGATAAAGGTAATTTAAAGCGGCACATGCGATCACATACCGGTGAGTAA
- Protein Sequence
- MRKHTGEKPFTCSHCSACFAGKGDLKQHMRTHTGEKPFTCSHCSACFAGKGNLKRHMRKHTGEKPFTCSHCSACFARKGNLKRHMRKHTGEEPFTCSHCSACFAGKGDLKQHMRTHTGEKPFRCSHCSACFAQKGHLNKHLRTHTDEKPLRCSQCAACFADKGNLKRHMRSHTGE
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00201952;
- 90% Identity
- iTF_00201952;
- 80% Identity
- iTF_00201952;