Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.012 13 5.6 0.0 21 44 6 29 2 33 0.87

2 6 0.00017 0.19 11.5 0.1 21 44 34 57 26 61 0.88

3 6 7.8e-05 0.089 12.5 0.1 21 44 62 85 57 89 0.90

4 6 0.01 11 5.8 0.0 21 45 90 114 86 121 0.84

5 6 0.009 10 5.9 0.2 21 45 118 142 114 145 0.90

6 6 0.0015 1.7 8.4 0.2 21 44 146 169 142 173 0.90

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.012	13	5.6	0.0	21	44	6	29	2	33	0.87
2	6	0.00017	0.19	11.5	0.1	21	44	34	57	26	61	0.88
3	6	7.8e-05	0.089	12.5	0.1	21	44	62	85	57	89	0.90
4	6	0.01	11	5.8	0.0	21	45	90	114	86	121	0.84
5	6	0.009	10	5.9	0.2	21	45	118	142	114	145	0.90
6	6	0.0015	1.7	8.4	0.2	21	44	146	169	142	173	0.90

Coding Sequence: ATGCGAAAACAtaccggtgaaaaaccattcactTGCAGCCATTGCTCGGCTTGTTTCGCTGGAAAAGGTGATTTAAAACAACACATGCGAACACATActggtgaaaaaccattcacttgcagccattgctcggcttgtttcgctggaaaaggaaatttaaaacgCCACATGCGAAAACATActggtgaaaaaccattcacttgcagccattgctcggcttgtttcgctagaaaaggaaatttaaaacgCCACATGCGAAAACATACCGGTGAAGAACCATTCACTTGTAGCCATTGCTCGGCTTGTTTCGCTGGAAAAGGTGATTTAAAACAACACATGCGAacacatactggtgagaaaccattcagatGCAGCCATTGCTCGGCTTGTTTCGCCCAGAAAGGACATTTAAATAAGCACTTGCGAACACATACCGATGAGAAACCACTCAGATGCAGCCAGTGCGCGGCCTGTTTTGCCGATAAAGGTAATTTAAAGCGGCACATGCGATCACATACCGGTGAGTAA
Protein Sequence: MRKHTGEKPFTCSHCSACFAGKGDLKQHMRTHTGEKPFTCSHCSACFAGKGNLKRHMRKHTGEKPFTCSHCSACFARKGNLKRHMRKHTGEEPFTCSHCSACFAGKGDLKQHMRTHTGEKPFRCSHCSACFAQKGHLNKHLRTHTDEKPLRCSQCAACFADKGNLKRHMRSHTGE

Sequence clustering based on sequence similarity using MMseqs2