Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 11 0.0078 8.8 6.1 0.1 21 45 6 30 3 33 0.90

2 11 0.00033 0.37 10.6 0.2 21 44 34 57 30 61 0.91

3 11 0.00049 0.56 10.0 0.0 21 44 62 85 58 89 0.90

4 11 0.0022 2.4 7.9 0.1 21 44 90 113 86 117 0.89

5 11 0.017 19 5.1 0.1 21 45 118 142 114 145 0.89

6 11 0.012 14 5.5 0.0 22 46 147 171 142 177 0.86

7 11 0.16 1.8e+02 2.0 0.1 21 44 174 197 170 202 0.84

8 11 0.01 12 5.8 0.2 21 46 202 227 198 233 0.84

9 11 0.21 2.4e+02 1.6 1.1 21 35 230 244 220 256 0.74

10 11 0.0041 4.6 7.1 0.1 21 46 258 283 253 289 0.86

11 11 0.0036 4.1 7.2 0.1 21 44 286 309 282 312 0.91

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	11	0.0078	8.8	6.1	0.1	21	45	6	30	3	33	0.90
2	11	0.00033	0.37	10.6	0.2	21	44	34	57	30	61	0.91
3	11	0.00049	0.56	10.0	0.0	21	44	62	85	58	89	0.90
4	11	0.0022	2.4	7.9	0.1	21	44	90	113	86	117	0.89
5	11	0.017	19	5.1	0.1	21	45	118	142	114	145	0.89
6	11	0.012	14	5.5	0.0	22	46	147	171	142	177	0.86
7	11	0.16	1.8e+02	2.0	0.1	21	44	174	197	170	202	0.84
8	11	0.01	12	5.8	0.2	21	46	202	227	198	233	0.84
9	11	0.21	2.4e+02	1.6	1.1	21	35	230	244	220	256	0.74
10	11	0.0041	4.6	7.1	0.1	21	46	258	283	253	289	0.86
11	11	0.0036	4.1	7.2	0.1	21	44	286	309	282	312	0.91

Coding Sequence: ATGCAAacacataccggtgagaaaccattcacttgcagtcattgctcggcttgtttcgctagaaaaggaaatttaataCAACACATGCAAacacataccggtgagaaaccatttacTTGCAGCCAGTGCTCGGCCCCTTTTGCTCAGAAACAACAGTTAAAACGCCACATGCGAACACAtaccggtgaaaaaccattcacttgcagccattgctcggcttgtttcgctggaaaaggaaatttaaaacgCCACATGCGAAAACAtaccggtgaaaaaccattcactTGCAGCCATTGCTCCGTCTGCTTCGCTCAAAAAGGAACTTTAAAACGGCACATGCGAACgcataccggtgagaaaccatttacttgcagccagtgctcggcttgtttcgctggaaaaggaaatttaataCAACACATGCAAACACAccctggtgagaaaccattcacttgcagccattgctcggcttgtttcgctggaaaaggaaatttaataCAACACATGCAAacacataccggtgagaaaccatttgcttgcagccattgctcggcttgtttcgctataaaaggaaatttaatacaacacatgcgaacacataccggtgagaaaccatttacTTGCAGCCATTGCTCCGTCTGCTTCGCTCATAAAGAAACTTTAAAACGGCACATGCGAacacataccggtgagaaaccattcactTGCAGCCAGTGCGCGGCCTGTTTTGCTCGAAGAGCTTTACTAGCGGGACATATTCGAACGCAcaccggtgagaaaccattcagatgcagccattgctcggcttgtttcgctggaaaaggaaatttaaaacgCCACATGCGAACACATACCGATGAGAAACCACTCAGATGCAGCCAGTGCGCGGCCTGTTTTGCCGATAAAGGTAATTTAAAGCGGCACATGCGATCACATACCGGTGAGTAA
Protein Sequence: MQTHTGEKPFTCSHCSACFARKGNLIQHMQTHTGEKPFTCSQCSAPFAQKQQLKRHMRTHTGEKPFTCSHCSACFAGKGNLKRHMRKHTGEKPFTCSHCSVCFAQKGTLKRHMRTHTGEKPFTCSQCSACFAGKGNLIQHMQTHPGEKPFTCSHCSACFAGKGNLIQHMQTHTGEKPFACSHCSACFAIKGNLIQHMRTHTGEKPFTCSHCSVCFAHKETLKRHMRTHTGEKPFTCSQCAACFARRALLAGHIRTHTGEKPFRCSHCSACFAGKGNLKRHMRTHTDEKPLRCSQCAACFADKGNLKRHMRSHTGE

Sequence clustering based on sequence similarity using MMseqs2