Bsom023394.1
Basic Information
- Insect
- Bedellia somnulentella
- Gene Symbol
- gprs
- Assembly
- GCA_963576735.1
- Location
- OY755184.1:15820862-15842140[+]
Transcription Factor Domain
- TF Family
- BTB
- Domain
- zf-C2H2|ZBTB
- PFAM
- PF00651
- TF Group
- Zinc-Coordinating Group
- Description
- The BTB (for BR-C, ttk and bab) [6] or POZ (for Pox virus and Zinc finger) [1] domain is present near the N-terminus of a fraction of zinc finger (Pfam:PF00096) proteins and in proteins that contain the Pfam:PF01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerisation and in some instances heteromeric dimerisation [1]. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule [2]. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT [5, 3, 4]. The POZ or BTB domain is also known as BR-C/Ttk or ZiN.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 1.3e-09 6.8e-07 30.7 0.0 9 45 57 96 50 114 0.83 2 2 2.6e-11 1.4e-08 36.2 0.0 36 106 133 202 128 205 0.85
Sequence Information
- Coding Sequence
- aTGGATATTAATCTCACTCGACATTTTAGTCTTGATGATGCTGATACGTCAATGCACATTGGGCTTCTACCAGAGCGTGTAGCAGCAATGGAAACGGACATTGACAACAGCACATTCGAGAACAAGACAGGTTTAGCCGAAGACATGAAGTTCCTCGCGTCCATGCCTGAGTTGTGTGACGTGACCTTCCTAGTGGGAGACACGAGGGAGCCTGTGTGTGCTGTCAAAGCTGTTTTGGCGGCTAGAAGCAGAGTTTTTCAAAAGATGCTTTATCATGCTCCAAGTCCTCAACGTAAGAAAGAGTCAGCGCCAAGAGAAAATAAACTGAGACTATTTCTGAAAAGATCCTCGGAGCCTCTTCTGAATCTACAAAACGCCGCACAACAAAGATCCACTTACGCGCTGCAATTGGCCCCAATTCAAGAGCCGACGCATCAACACCAGACCTTGATCATTGAGGAATTCGAACCTGACGTGTTTCGGCAGCTCATAGAGTATATACATACCGGATGCGTGACTCTTCAGCCGAGGACTTTACTTGGAGTAATGAACGCTGCAGATTACTACGGCCTCGATGAGTTGCGCCGCGCATGCGCCGGTTTCGTCCAATGCTGCATCACTGTCGACACCGTCTGCGCTTTGTTGGCGTCCGCTGAGAGATATATACAGTATAAGTGTACTAAGAGTTTGGTTCAGAAGAAATCTTTGTTTCATGCCAGAAACGTTCCTAGCATTATCAAGTCGATTCTTGGTAAATTTGCGCTGGAAGCCTTTGTAAATCCTTATGGATGTTATGGAAATAACTGA
- Protein Sequence
- MDINLTRHFSLDDADTSMHIGLLPERVAAMETDIDNSTFENKTGLAEDMKFLASMPELCDVTFLVGDTREPVCAVKAVLAARSRVFQKMLYHAPSPQRKKESAPRENKLRLFLKRSSEPLLNLQNAAQQRSTYALQLAPIQEPTHQHQTLIIEEFEPDVFRQLIEYIHTGCVTLQPRTLLGVMNAADYYGLDELRRACAGFVQCCITVDTVCALLASAERYIQYKCTKSLVQKKSLFHARNVPSIIKSILGKFALEAFVNPYGCYGNN
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00355363; iTF_00711143; iTF_01204209;
- 90% Identity
- -
- 80% Identity
- -