Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.0023 1e+02 4.0 1.8 11 16 13 18 11 20 0.83

2 5 0.049 2.2e+03 -0.3 1.0 12 15 32 35 31 35 0.94

3 5 3.9e-10 1.8e-05 25.6 2.2 4 21 52 69 50 70 0.87

4 5 0.62 2.8e+04 -3.8 6.9 10 15 82 87 81 88 0.83

5 5 0.16 7e+03 -1.9 0.1 6 9 92 95 90 96 0.80

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.0023	1e+02	4.0	1.8	11	16	13	18	11	20	0.83
2	5	0.049	2.2e+03	-0.3	1.0	12	15	32	35	31	35	0.94
3	5	3.9e-10	1.8e-05	25.6	2.2	4	21	52	69	50	70	0.87
4	5	0.62	2.8e+04	-3.8	6.9	10	15	82	87	81	88	0.83
5	5	0.16	7e+03	-1.9	0.1	6	9	92	95	90	96	0.80

Coding Sequence: ATGTCGGATGACGGATCCACGGCTGTTGAAAAGAAAGGAAGAGGCAGACCTAAAGCTAATGGCACCTCAGAAGCCAAAGGTGATGCCAAGAAAAGGGGACGACCTGTGGTACCTGCCAAAGCTAAAGAATCCACCAAATCCTCTGACGATGAGCAAGCGCCAGTAGCAAAGCGAGGCCGTGGCAGACCCAAAGGCTCCAAAAAGAAGGCTGCTGCTCCTAAAGCCAAGtCTTCTGGAGATGGCCGAGGTCGTGGCCGACCACGCAAGGATGCCCCAGCTCCTAAAAAGGATGCTACCTCTGAAGAAGATCAAGAAGAGGATGAAGAAGATGAAGGTTCTGATCAGTAA
Protein Sequence: MSDDGSTAVEKKGRGRPKANGTSEAKGDAKKRGRPVVPAKAKESTKSSDDEQAPVAKRGRGRPKGSKKKAAAPKAKSSGDGRGRGRPRKDAPAPKKDATSEEDQEEDEEDEGSDQ

Sequence clustering based on sequence similarity using MMseqs2