Bsom013624.1
Basic Information
- Insect
- Bedellia somnulentella
- Gene Symbol
- Rfx2_1
- Assembly
- GCA_963576735.1
- Location
- OY755176.1:17698472-17700316[+]
Transcription Factor Domain
- TF Family
- RFX
- Domain
- RFX domain
- PFAM
- PF02257
- TF Group
- Basic Domians group
- Description
- RFX is a regulatory factor which binds to the X box of MHC class II genes and is essential for their expression. The DNA-binding domain of RFX is the central domain of the protein and binds ssDNA as either a monomer or homodimer [1]. It recognize X-boxes (DNA of the sequence 5'-GTNRCC(0-3N)RGYAAC-3', where N is any nucleotide, R is a purine and Y is a pyrimidine) using a highly conserved 76-residue DNA-binding domain (DBD) [2].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 5.1e-33 1.1e-28 100.9 0.4 16 78 28 90 19 91 0.94
Sequence Information
- Coding Sequence
- ATGAAACAGACAAACGGAACATTTAAAATCCATATGGCACTTGAGATGTCCGACCGTGTATTACAAGTACAGTCACTAAGGCTTGGTGTATCCCTCCCCCGTTCAACATTATACGCGCACTACCTCCGCCATTGCGCGACCCACCGCCTCGACCCGGTAAACGCAGCTTCGTTTGGCAAACTAATTCGCTCAGTCTTCGTCGGGCTTCGAACCCGGCGGCTCGGGACGCGAGGCAACTCCAAGTACCACTACTACGGGATCCGAGCCAAGCCTAATGCAGTCGATAGTTCGCCGAAAGAAGAGTCTGAGGAGAAAACTGACGTGGAGACTCAGGTTGGTTACTTCTATTTGTCTTTGTATAGGGATTGTACAAGCTAA
- Protein Sequence
- MKQTNGTFKIHMALEMSDRVLQVQSLRLGVSLPRSTLYAHYLRHCATHRLDPVNAASFGKLIRSVFVGLRTRRLGTRGNSKYHYYGIRAKPNAVDSSPKEESEEKTDVETQVGYFYLSLYRDCTS
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -