Bpel003708.1
Basic Information
- Insect
- Barypeithes pellucidus
- Gene Symbol
- ZNF131_3
- Assembly
- GCA_963991005.1
- Location
- OZ022556.1:43409872-43410780[-]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 7 0.81 1.3e+04 -2.2 0.0 24 48 13 37 6 39 0.78 2 7 0.07 1.1e+03 1.2 0.0 21 43 39 61 30 67 0.85 3 7 0.0092 1.4e+02 4.0 0.5 15 44 90 119 81 123 0.87 4 7 0.00016 2.4 9.7 0.0 20 44 123 147 120 154 0.90 5 7 0.00037 5.8 8.5 0.0 22 52 153 183 148 184 0.87 6 7 1.3e-05 0.2 13.2 0.3 21 51 180 209 178 212 0.89 7 7 0.022 3.4e+02 2.8 0.0 22 30 237 245 229 262 0.83
Sequence Information
- Coding Sequence
- ATGGAAAGTCACACGTCAGTGCACACTGGAGAAAGAAAATTCGAATGTAGCGAATGCTGCGCTAGATTTTGCCAGAAGACACTGTTGGAGGAGCACATAAAAGACCAACATATTGATGAAATACCGTTTAAGTGTGACTTAtgccaaaaatttttttccacaatatggAACTTGGAAAGACACAAATTAATACACACTGGAGAGAAAAGATTTGAATGTTACGAATGTCACACTCGATATGCCCATAAGGCAattctaataaaacacatacGTAGTCGACATACTGGTGAAAGGCCATTTAAATGTCAACGCTGTCCGAAGGCCTTTGCTGCCAAGTCGAACTTAAATAGTCATATTAAAACACACCAAGGCCTAAGGCCCTACACATGTGGCATTTGCGAACATCAATTTTCTCAAAAGTCAAATTTAAAGAAGCACATTGCCGGCCATTCCGGAGAAAAGACCATCGAGTGTCCCGTTTGCCATAAAAAGTTTTCAACTAAATATAACTTACAATCTCATATGGAGGTACATAATGGTGAAAAGCCATACTTTTGTGATATTTGTTATGAAAGTTTCAGACACGCGACACAATTGCGAGTACATCGAATGACACATTTTGGCAAACGACCGTACACTTGCACTACGTGCGGAATGAACTTTCTGCACCAGTCTGGCCTAACCGTGCACTCAAAAACGCATTTAGGCGATAAACCTTTCTCGTGTCCTATATGCGGCAAAAAGTTTGTCAAAGAATCTATAGTTGCTAGCCATATGACGCTGCATACGGGAGAAAAACAGTTTGAATGCTTCCTGTGTAGGAAAAGATATGCTGATAAGTCGAAGTTAAATTATCATCTTAAGAAAAAATGTCTTAAAGGTATTAGTATGTCAATACAAGCTCGTTAG
- Protein Sequence
- MESHTSVHTGERKFECSECCARFCQKTLLEEHIKDQHIDEIPFKCDLCQKFFSTIWNLERHKLIHTGEKRFECYECHTRYAHKAILIKHIRSRHTGERPFKCQRCPKAFAAKSNLNSHIKTHQGLRPYTCGICEHQFSQKSNLKKHIAGHSGEKTIECPVCHKKFSTKYNLQSHMEVHNGEKPYFCDICYESFRHATQLRVHRMTHFGKRPYTCTTCGMNFLHQSGLTVHSKTHLGDKPFSCPICGKKFVKESIVASHMTLHTGEKQFECFLCRKRYADKSKLNYHLKKKCLKGISMSIQAR
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00196604;
- 90% Identity
- iTF_00196604;
- 80% Identity
- iTF_00196604;