Aibi013457.1
Basic Information
- Insect
- Atherix ibis
- Gene Symbol
- -
- Assembly
- GCA_958298945.2
- Location
- OY282607.1:31733746-31735220[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 6 0.11 5.3e+02 1.5 0.0 26 45 39 58 32 61 0.89 2 6 0.0039 18 6.1 0.1 23 45 64 86 60 89 0.89 3 6 5e-06 0.023 15.4 0.1 21 48 90 116 85 121 0.85 4 6 0.018 85 4.0 0.1 21 45 118 142 116 146 0.90 5 6 0.0015 7.2 7.4 0.1 20 45 145 170 142 175 0.88 6 6 1.9 8.9e+03 -2.5 0.0 27 34 188 195 186 204 0.77
Sequence Information
- Coding Sequence
- ATGCGAAAAAGGCGTCATTTCATAATAGGCAAACAAATCGCTTTTGATTTTAAGCGTGATTTgcttttacataataaaacaaCACATGCAACTAATCCGGAGAATAGTCGATTCGTTTGTCAAATATGTAACAAAGGATTTGCGAACTTAGGGAATTTATATCGTCATCTGAAGGGACACGGTGATGTCCGACCATACGAATGTAAAATATGCGGCAAGAAATTTGCCCAGGCAGTAAATTTAAATCGACATTATTCAGTTCATTCTGGTGAACGACCATTCACTTGTAATATTTGCAATAAGAGCTTCACGCAACAGGGGAATCTTAAAAGACACGAACTTATACATACCGGCGAGAAACCTTTCCGATGTAAACGGTGCGGTCGAATGTTTTCACAAAGGATCAACCTCAAAAAACACGTTATGATGCATCAAGGCTATCGACCATATTCATGTGATATCTGCAATAAATCATTTCTGCAAACGCAAAACTATAAAAAGCATATGGCACGGCATTCGATCACCACAGTTAAAACTGAGGAAgctaaattATTTTACGAATGCGCTATTTGTACAacagtttttgataatttttctgatTTCCAATCGCATGAAATATTTTGTGAAGTTGCTGGCGAAGAGCAAATagaaacaacagcaacatcatcagCAGCATCAGCTACAACTAATAGCAATAGTACTCCAAATCCAAACGAATTGGTTACTAATACAtcttaa
- Protein Sequence
- MRKRRHFIIGKQIAFDFKRDLLLHNKTTHATNPENSRFVCQICNKGFANLGNLYRHLKGHGDVRPYECKICGKKFAQAVNLNRHYSVHSGERPFTCNICNKSFTQQGNLKRHELIHTGEKPFRCKRCGRMFSQRINLKKHVMMHQGYRPYSCDICNKSFLQTQNYKKHMARHSITTVKTEEAKLFYECAICTTVFDNFSDFQSHEIFCEVAGEEQIETTATSSAASATTNSNSTPNPNELVTNTS
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00176594;
- 90% Identity
- iTF_00176594;
- 80% Identity
- iTF_00176594;