Asph031419.1
Basic Information
- Insect
- Asteroscopus sphinx
- Gene Symbol
- Sox15_1
- Assembly
- GCA_949699075.1
- Location
- OX453023.1:14465856-14468701[+]
Transcription Factor Domain
- TF Family
- HMG
- Domain
- HMG_box domain
- PFAM
- PF00505
- TF Group
- Other Alpha-Helix Group
- Description
- High mobility group (HMG) box domains are involved in binding DNA, and may be involved in protein-protein interactions as well. The structure of the HMG-box domain consists of three helices in an irregular array. HMG-box domains are found in one or more copies in HMG-box proteins, which form a large, diverse family involved in the regulation of DNA-dependent processes such as transcription, replication, and strand repair, all of which require the bending and unwinding of chromatin. Many of these proteins are regulators of gene expression. HMG-box proteins are found in a variety of eukaryotic organisms, and can be broadly divided into two groups, based on sequence-dependent and sequence-independent DNA recognition; the former usually contain one HMG-box motif, while the latter can contain multiple HMG-box motifs. HMG-box domains can be found in single or multiple copies in the following protein classes: HMG1 and HMG2 non-histone components of chromatin; SRY (sex determining region Y protein) involved in differential gonadogenesis; the SOX family of transcription factors [1]; sequence-specific LEF1 (lymphoid enhancer binding factor 1) and TCF-1 (T-cell factor 1) involved in regulation of organogenesis and thymocyte differentiation [2]; structure-specific recognition protein SSRP involved in transcription and replication; MTF1 mitochondrial transcription factor; nucleolar transcription factors UBF 1/2 (upstream binding factor) involved in transcription by RNA polymerase I; Abf2 yeast ARS-binding factor [3]; yeast transcription factors lxr1, Rox1, Nhp6b and Spp41; mating type proteins (MAT) involved in the sexual reproduction of fungi [4]; and the YABBY plant-specific transcription factors.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 5.3e-14 7.6e-11 43.6 0.0 2 36 97 131 96 144 0.88
Sequence Information
- Coding Sequence
- aTGATGGATTCCGGAGGGGCTGGCATCGCTGAATCCCCACCTACGTACCACCGTACTTATGAGCAATATGTGCAAGGAGCCGTGGAGAACAGTACCGACTCAGTGCAAGAACAAACAAGCCCCGAACTCGTAGTGTGGTCAACCCTACCATACGGCCTGGATTACAGAGCGCAATACGACTATAGGAGCCCTTATGATACTGGCAGGGACTACTCCACCCAGCAGTACGCAAGGGCCCCATTTACCACGAAGATGGGACAAGCCAAGGCCCTTAAAGAGGCCCGGATAAGAAGGCCGATGAATGCGTTCATGGTGTGGGCGAAGGTTGAAAGGAAGAAGCTGGCTGACGAGAATCCGGATCTGCATAATGCTGATTTGAGTAAAATGCTAGGACCTTATACCACCGCAGGATGGTCTAATTTACCGAAATTTTCTTCAAAATCGTTGAGGGGCTAA
- Protein Sequence
- MMDSGGAGIAESPPTYHRTYEQYVQGAVENSTDSVQEQTSPELVVWSTLPYGLDYRAQYDYRSPYDTGRDYSTQQYARAPFTTKMGQAKALKEARIRRPMNAFMVWAKVERKKLADENPDLHNADLSKMLGPYTTAGWSNLPKFSSKSLRG
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01147377;
- 90% Identity
- iTF_01140916;
- 80% Identity
- iTF_00120514; iTF_00186179; iTF_00928707; iTF_01027331; iTF_00685444; iTF_01439940; iTF_00667493; iTF_00121446; iTF_00147462; iTF_00745703; iTF_01221575; iTF_01441095; iTF_01094920; iTF_01526024; iTF_00039818; iTF_01028298; iTF_00907051; iTF_01031147; iTF_01425067; iTF_00042636; iTF_00374124; iTF_01246988; iTF_01338764; iTF_00071437; iTF_00906157; iTF_00043502; iTF_00888270; iTF_01093102; iTF_00124272; iTF_00041778; iTF_00049906; iTF_01533938; iTF_01532019; iTF_00123380; iTF_00040821; iTF_00449109; iTF_01063765; iTF_00036727; iTF_01029271; iTF_00038777; iTF_00037819; iTF_00711867; iTF_01094043; iTF_00726364; iTF_01030236; iTF_01064668; iTF_00758173; iTF_00831229; iTF_00364031; iTF_00122400; iTF_00185312; iTF_01527232; iTF_00450116; iTF_01377476; iTF_00273605; iTF_01061894; iTF_00177129; iTF_00809143; iTF_00810073; iTF_00274431; iTF_00383657; iTF_01026189; iTF_01534836; iTF_01062805; iTF_01340117; iTF_00375223; iTF_00771930; iTF_00952719; iTF_00018168; iTF_00951838; iTF_01538750; iTF_00851807; iTF_00850746; iTF_01117215;