Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 6.8e-05 0.17 14.1 0.1 21 48 11 38 6 42 0.89

2 7 1.5 3.5e+03 0.2 0.0 26 48 45 67 39 72 0.80

3 7 0.16 3.7e+02 3.4 0.5 21 48 69 96 65 98 0.84

4 7 5.3e-05 0.13 14.5 0.5 18 48 95 125 92 130 0.90

5 7 0.011 27 7.0 0.4 19 51 125 157 123 160 0.81

6 7 0.047 1.1e+02 5.0 0.1 22 48 157 183 155 185 0.86

7 7 0.045 1.1e+02 5.1 0.5 18 48 182 212 180 215 0.82

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	6.8e-05	0.17	14.1	0.1	21	48	11	38	6	42	0.89
2	7	1.5	3.5e+03	0.2	0.0	26	48	45	67	39	72	0.80
3	7	0.16	3.7e+02	3.4	0.5	21	48	69	96	65	98	0.84
4	7	5.3e-05	0.13	14.5	0.5	18	48	95	125	92	130	0.90
5	7	0.011	27	7.0	0.4	19	51	125	157	123	160	0.81
6	7	0.047	1.1e+02	5.0	0.1	22	48	157	183	155	185	0.86
7	7	0.045	1.1e+02	5.1	0.5	18	48	182	212	180	215	0.82

Coding Sequence: atgaaaaaacatattatggctcatcatacaggtgagaagcctcatcaatgccccctttgtgattataaatcagtttTTTCTGGAAATGTGAAAAGGCATATAGCGGTCCGTCATACGGGTGGGAAGACCCATCAATGCCCCTACTGCGATTATAAATCTTTACtatctggaaatatgaaaaatcatataatggcccatcatacaggtgaaaagcctcatcACTGTCCTCACTGTGACTATAAATCTGTTGAATCTGGATGCATGAAAAGCCatataatggcccgtcatacaggtgagaagcctcatcaatgtcctcactgtgattataaatctgttgAATCAAGAGATATGAAAAGGCATATAATGGCCCGTCACACAGATGAGAAGTCCTAtaaatgtcctcactgtgattataaatcagtttATTTTGGAAATGTGAAAAGACATATAATGGTTCGTCATACAGCtgagaagtcctatcaatgTCCTtgttgtgattataaatctgtttattctggaaatgtaaaaaaacatataatggccaGGCATaaaggtgagaagcctcatcaatgtcctcactgtgattatagaTCTGTAGAATCTGGATgtatgaaaaaacatataatggccaAGCACAAAGGTGAGAAGTCCTAA
Protein Sequence: MKKHIMAHHTGEKPHQCPLCDYKSVFSGNVKRHIAVRHTGGKTHQCPYCDYKSLLSGNMKNHIMAHHTGEKPHHCPHCDYKSVESGCMKSHIMARHTGEKPHQCPHCDYKSVESRDMKRHIMARHTDEKSYKCPHCDYKSVYFGNVKRHIMVRHTAEKSYQCPCCDYKSVYSGNVKKHIMARHKGEKPHQCPHCDYRSVESGCMKKHIMAKHKGEKS

Sequence clustering based on sequence similarity using MMseqs2