Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.0023 5.6 9.2 0.1 18 49 3 34 2 38 0.89

2 6 0.27 6.4e+02 2.6 1.8 19 48 33 62 32 68 0.76

3 6 1.2 3e+03 0.5 2.4 22 48 65 91 57 91 0.72

4 6 7.7e-06 0.019 17.1 0.5 16 48 88 120 84 122 0.92

5 6 0.00011 0.28 13.4 0.7 19 49 120 150 119 154 0.87

6 6 0.038 92 5.3 0.7 19 48 149 178 148 180 0.86

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.0023	5.6	9.2	0.1	18	49	3	34	2	38	0.89
2	6	0.27	6.4e+02	2.6	1.8	19	48	33	62	32	68	0.76
3	6	1.2	3e+03	0.5	2.4	22	48	65	91	57	91	0.72
4	6	7.7e-06	0.019	17.1	0.5	16	48	88	120	84	122	0.92
5	6	0.00011	0.28	13.4	0.7	19	49	120	150	119	154	0.87
6	6	0.038	92	5.3	0.7	19	48	149	178	148	180	0.86

Coding Sequence: ATGTACCGTCATACAGATGAGAAGCCGTATCCATGCCCTCACTGTGACTTTAAAGCAGTACAAGTTAGTACCTTAAAAAAACATGTGATGTACCGTCACactggtgagaagcctcatcaatgtccacaATGTGAATATAGAACTGTAACAACTGGGGTTTTAAATGCACATATAAAGCACCGTCATTCAGGTTTGAAGCCTCATCAGTGTCCTCACTGCGATTATAAAACagcattaattattcatttaagaaatcatatcaggtcccgtcatacaggtgagaagccaaATCagtgtcctcactgtgattataaaactGTAACAAGTCGTGTATTAAAAAACCACATAATGTATCggcatacaggtgagaagccgtatcaatgtccacattgtaACTATAAAGCTGTACAAGTTAGTAACCTAAAAAAACACGTGATGTACCGTCATACTGGAGAGAAGCCTTATCAATGCCCTCACTGTGcatataaaactgtaacaagtgatgttttaaattcacatataAAGCGCCGACATACTGATGGCTGA
Protein Sequence: MYRHTDEKPYPCPHCDFKAVQVSTLKKHVMYRHTGEKPHQCPQCEYRTVTTGVLNAHIKHRHSGLKPHQCPHCDYKTALIIHLRNHIRSRHTGEKPNQCPHCDYKTVTSRVLKNHIMYRHTGEKPYQCPHCNYKAVQVSNLKKHVMYRHTGEKPYQCPHCAYKTVTSDVLNSHIKRRHTDG

Sequence clustering based on sequence similarity using MMseqs2