Acus000260.1
Basic Information
- Insect
- Arma custos
- Gene Symbol
- -
- Assembly
- GCA_037127475.1
- Location
- CM073759.1:4764036-4764503[-]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 5 0.013 32 6.8 0.7 22 50 12 40 7 44 0.84 2 5 0.075 1.8e+02 4.4 0.9 21 48 40 67 37 70 0.83 3 5 0.0004 0.96 11.7 0.9 17 49 65 97 52 101 0.86 4 5 0.00064 1.5 11.0 0.4 21 48 98 125 95 127 0.91 5 5 1.2e-05 0.029 16.5 0.7 18 48 124 154 122 155 0.93
Sequence Information
- Coding Sequence
- ATGAAAAGGCATATAATGGTCTGCCATAAAGAGGAGAAATCTCATCAAtgccctcactgtgattataaatcagcaagaTCTGTTACTATGAAAAGGCatataatggcccgtcatataggggagaagcctcatcaatgtcctcactgtgattataaatcagcaagatctggaactatgaaaatacatgtgatggcccgtcatacaactgagaagcctcatcaatgtcctcactgtggtTATAAATCAGCAAAATCTGGATGTGTGAAAAGGCatataatggcccgtcatataggggagaagcctcatcaatgtcctcactgtgattataaatcagcactatctggaaatatgaaaaggCATGTAATGGCCCGCCATGCAactgagaagcctcatcaatgtcctcactgtgattataaatcagcacaatctggaaatatgaaaaggCATGTGATGGCCCGTCACAGGTAa
- Protein Sequence
- MKRHIMVCHKEEKSHQCPHCDYKSARSVTMKRHIMARHIGEKPHQCPHCDYKSARSGTMKIHVMARHTTEKPHQCPHCGYKSAKSGCVKRHIMARHIGEKPHQCPHCDYKSALSGNMKRHVMARHATEKPHQCPHCDYKSAQSGNMKRHVMARHR
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00165629;
- 90% Identity
- iTF_00165629;
- 80% Identity
- iTF_00165629;