Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 0.00097 2.3 10.4 0.2 17 48 7 38 3 43 0.88

2 8 0.097 2.3e+02 4.0 0.4 21 48 40 67 36 69 0.89

3 8 0.028 68 5.7 0.2 17 48 65 96 60 98 0.86

4 8 0.0057 14 8.0 0.2 21 48 98 125 94 128 0.89

5 8 0.037 89 5.3 0.2 18 45 124 151 122 156 0.83

6 8 0.065 1.6e+02 4.6 0.3 21 48 156 183 153 185 0.87

7 8 0.046 1.1e+02 5.0 0.2 21 48 185 212 182 214 0.88

8 8 0.00025 0.6 12.3 0.2 17 48 210 241 200 245 0.87

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	0.00097	2.3	10.4	0.2	17	48	7	38	3	43	0.88
2	8	0.097	2.3e+02	4.0	0.4	21	48	40	67	36	69	0.89
3	8	0.028	68	5.7	0.2	17	48	65	96	60	98	0.86
4	8	0.0057	14	8.0	0.2	21	48	98	125	94	128	0.89
5	8	0.037	89	5.3	0.2	18	45	124	151	122	156	0.83
6	8	0.065	1.6e+02	4.6	0.3	21	48	156	183	153	185	0.87
7	8	0.046	1.1e+02	5.0	0.2	21	48	185	212	182	214	0.88
8	8	0.00025	0.6	12.3	0.2	17	48	210	241	200	245	0.87

Coding Sequence: ATGAAAAATcatgtaatggcccgtcataaaggtgagaagcctcatcagtgtcctcactgtgattataaatcagcacaatcTGGAACTATGAAAAGGCATGTAATGGCctgtcatacaggtgagaagcctcatcaatgtcctcactgtgattataaatcagcaaatTCTGGACACATGAAAAATcatgtaatggcccgtcatacaggtgagaagcctcatcaatgtcctcactgtgactttaaatcagcacaatctggacaaatgaaaatTCATGTAATGGCCcatcatacaggtgagaagccttatcaatgtcctcactgtgattataaatcagcaagatctggaaatatgaaaaatcatgtaatggcccgtcatacaggtgagaagcctcatcaatgtccttactgtgattataaatcagcacaatctggagctatgaaaatacatgtaatggcctgtcatacaggtgagaagcctcatcaatgtcctcactgtgattataaatcagcacaatctggacacatgaaaaatcatgtaatggcccatcatacaggtgagaagcctcatcaatgtcctcagtgtgattataaatcagtgaACTCTGGAACTATGAAAAAACATGTTATGGCCCggcatacaggtgagaagcctcatcaatgtcctcactgtgattatacaTCAGCAGAATCTGGAAAGATTAAAAGACATATAATAGTCCGTCATAAAGGGGAGAAACGTCATCAATGTCCTCTCTAA
Protein Sequence: MKNHVMARHKGEKPHQCPHCDYKSAQSGTMKRHVMACHTGEKPHQCPHCDYKSANSGHMKNHVMARHTGEKPHQCPHCDFKSAQSGQMKIHVMAHHTGEKPYQCPHCDYKSARSGNMKNHVMARHTGEKPHQCPYCDYKSAQSGAMKIHVMACHTGEKPHQCPHCDYKSAQSGHMKNHVMAHHTGEKPHQCPQCDYKSVNSGTMKKHVMARHTGEKPHQCPHCDYTSAESGKIKRHIIVRHKGEKRHQCPL

Sequence clustering based on sequence similarity using MMseqs2