Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 0.0017 4.2 9.6 0.1 17 49 7 39 3 43 0.90

2 9 0.29 7e+02 2.5 0.2 19 44 38 63 37 69 0.78

3 9 0.038 93 5.3 0.1 21 49 69 97 56 101 0.84

4 9 0.015 37 6.6 0.3 18 48 95 125 93 127 0.88

5 9 0.00014 0.34 13.1 0.5 17 48 123 154 116 157 0.91

6 9 0.0052 13 8.1 0.8 18 49 153 184 151 192 0.91

7 9 0.22 5.2e+02 2.9 0.2 21 44 214 237 202 243 0.84

8 9 0.041 98 5.2 0.4 21 48 243 270 239 272 0.91

9 9 0.0013 3 10.1 0.3 18 49 269 300 267 305 0.90

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	0.0017	4.2	9.6	0.1	17	49	7	39	3	43	0.90
2	9	0.29	7e+02	2.5	0.2	19	44	38	63	37	69	0.78
3	9	0.038	93	5.3	0.1	21	49	69	97	56	101	0.84
4	9	0.015	37	6.6	0.3	18	48	95	125	93	127	0.88
5	9	0.00014	0.34	13.1	0.5	17	48	123	154	116	157	0.91
6	9	0.0052	13	8.1	0.8	18	49	153	184	151	192	0.91
7	9	0.22	5.2e+02	2.9	0.2	21	44	214	237	202	243	0.84
8	9	0.041	98	5.2	0.4	21	48	243	270	239	272	0.91
9	9	0.0013	3	10.1	0.3	18	49	269	300	267	305	0.90

Coding Sequence: ATGAAAAATCATGTAATGGCCCgccatacaggtgagaagcctcatcaatgtcctcactgtgattataaatcagcacaatcTGGAGCTATGAAAATACATGTAATGGTCCggcatacaggtgagaagcctcatcactgtcctcactgtgattataaatcagcagaaTCTGGAACTATGAAAAAACATGTTATGGCCtatcatacaggtgagaagcctcatcaatgtcctcactgtgactTTAAATCAGCAAGGTTTGGAGATATGAAAAGACATGtgatggcccgtcatacaggtgagaagcctcatcaatgtcctcactgtgattataaatcagtgaACTCTGCAACTATGAAAAAACATGTTATGGCCCggcatacaggtgagaagcctcatcgttgtcctcactgtgattataaatcagcacaatcTGCAGATATGAAAAGACATGtgatggcccgtcatacaggtgagaagcctcatcactgtcctcactgtgattataaatcagcacaatctggacacatgaaaaatcatgtaatggcccgtcatacaggtgagaagcatcatcaatgtcctcagtgtgattataaatcagccaTATCTGGAACCATGAAAATACATGTAATGGCctgtcatacaggtgagaagcctcatcactgtcctcactgtgattataaatcagcacaatctggagctatgaaaatacatgtaatggcctgtcatacaggtgagaagcctcatcaatgtcctcactgtgattataaatcagcgaACTCTGCAACTATGAAAAAACATGTTATGGCCCggcatacaggtgagaagcctcatcactgtcctcactgtgattataaatcagcacaatcTGGAACTATGAAAAAACATGTTATGGCCCggcatacaggtgagaagcctcatcaatgtcctcccTAA
Protein Sequence: MKNHVMARHTGEKPHQCPHCDYKSAQSGAMKIHVMVRHTGEKPHHCPHCDYKSAESGTMKKHVMAYHTGEKPHQCPHCDFKSARFGDMKRHVMARHTGEKPHQCPHCDYKSVNSATMKKHVMARHTGEKPHRCPHCDYKSAQSADMKRHVMARHTGEKPHHCPHCDYKSAQSGHMKNHVMARHTGEKHHQCPQCDYKSAISGTMKIHVMACHTGEKPHHCPHCDYKSAQSGAMKIHVMACHTGEKPHQCPHCDYKSANSATMKKHVMARHTGEKPHHCPHCDYKSAQSGTMKKHVMARHTGEKPHQCPP

Sequence clustering based on sequence similarity using MMseqs2