Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 0.004 9.6 8.5 0.1 17 48 7 38 3 41 0.92

2 7 0.00013 0.32 13.2 0.2 6 48 25 67 22 69 0.87

3 7 0.0013 3.2 10.0 0.2 18 48 66 96 65 99 0.91

4 7 0.014 35 6.7 0.3 18 48 95 125 93 127 0.90

5 7 0.0014 3.5 9.9 0.2 18 49 124 155 121 159 0.90

6 7 0.049 1.2e+02 5.0 0.3 18 44 153 179 151 184 0.83

7 7 0.05 1.2e+02 4.9 0.4 20 48 184 212 180 214 0.90

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	0.004	9.6	8.5	0.1	17	48	7	38	3	41	0.92
2	7	0.00013	0.32	13.2	0.2	6	48	25	67	22	69	0.87
3	7	0.0013	3.2	10.0	0.2	18	48	66	96	65	99	0.91
4	7	0.014	35	6.7	0.3	18	48	95	125	93	127	0.90
5	7	0.0014	3.5	9.9	0.2	18	49	124	155	121	159	0.90
6	7	0.049	1.2e+02	5.0	0.3	18	44	153	179	151	184	0.83
7	7	0.05	1.2e+02	4.9	0.4	20	48	184	212	180	214	0.90

Coding Sequence: ATGAAAAATcatgtaatggcccgtcatacaggtgagaagcctcatcaatgtcctcactgtgactttaaatcagcacaatctggaccaatgaaaaatcatgtaatggcccgtcataaaggtgagaagcctcatcagtgtcctcactgtgattataaatcagcacaatcTGGAACTATGAAAAAACATGTTATGGCCCggcatacaggtgagaagcctcatcaatgtcctcactgtgattataaatcagcagaaTCTGGAGATATGAAAAGACATGtgatggcccgtcatacaggtgagaagcctcatcactgtcctcactgtgattataaatcagcagatTCTGGACacatgaaaaaacattttatggcccggcatacaggtgagaagcctcatcaatgtcctcactgtgattataaatcagcacaatctggagctatgaaaaatcatgtaatggcccgtcatacaggtgagaagcctcatcaatgtcctcactgtgattataaatcagcacaatctggagctatgaaaatacatataatgGCCTGTCATaaaggtgagaagcctcatcactgtccTCACTGTGACTTTAAATCAGCAAGGTCTGGAGCtattaaaaaacatgtaattGCCCGTCATAGAGGTTag
Protein Sequence: MKNHVMARHTGEKPHQCPHCDFKSAQSGPMKNHVMARHKGEKPHQCPHCDYKSAQSGTMKKHVMARHTGEKPHQCPHCDYKSAESGDMKRHVMARHTGEKPHHCPHCDYKSADSGHMKKHFMARHTGEKPHQCPHCDYKSAQSGAMKNHVMARHTGEKPHQCPHCDYKSAQSGAMKIHIMACHKGEKPHHCPHCDFKSARSGAIKKHVIARHRG

Sequence clustering based on sequence similarity using MMseqs2