Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.0076 18 7.6 0.4 16 48 3 35 1 38 0.89

2 6 0.0084 20 7.4 0.2 18 48 34 64 33 67 0.90

3 6 0.00023 0.56 12.4 0.3 18 48 63 93 61 95 0.92

4 6 0.00051 1.2 11.3 0.5 18 50 92 124 90 129 0.89

5 6 0.11 2.7e+02 3.8 0.1 18 48 121 151 120 154 0.90

6 6 0.001 2.5 10.3 0.6 17 51 149 183 144 185 0.88

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.0076	18	7.6	0.4	16	48	3	35	1	38	0.89
2	6	0.0084	20	7.4	0.2	18	48	34	64	33	67	0.90
3	6	0.00023	0.56	12.4	0.3	18	48	63	93	61	95	0.92
4	6	0.00051	1.2	11.3	0.5	18	50	92	124	90	129	0.89
5	6	0.11	2.7e+02	3.8	0.1	18	48	121	151	120	154	0.90
6	6	0.001	2.5	10.3	0.6	17	51	149	183	144	185	0.88

Coding Sequence: ATGAAAAGGGTCCGTCATAAAGAGGAGAAGCTTAATCAAtgccctcactgtgattataaatcagcgaGATCTGGAGCTATGAAAAGAcatgtaatggcccgtcatacaggtgagaaacCTCATCAATGCCCatactgtgattataaatcagcagaaTCTGGAAAgataaaattacatattatgGTCCgacatacaggtgagaagcctcatcaatgtcctcactgtgattataaatcagcagaaTCTGGAAACATTAAAAGACATGTTATGGCCCGTCATAAAGGGGAGAAGCCCTATCAATGTCcacactgtgattataaatcagcaaatTCTGGAGATATAAAAAGACATGTAATGGCGCGTCATACATGTGAGAAGCCTCATCTCTGTTCTCACTGCGATTATAAGTCAGCAGACTCAGGAGATATGAAAAAACATGttatggcccgtcatacaggtgagaagcctcatcaatgtccttactgtgattataaatctgcaATACCGGGAACTTTGAAAAGAcatgtaatggcccgtcatatAGCTCAGAAGACTCATCGATGTCCTCTTTAA
Protein Sequence: MKRVRHKEEKLNQCPHCDYKSARSGAMKRHVMARHTGEKPHQCPYCDYKSAESGKIKLHIMVRHTGEKPHQCPHCDYKSAESGNIKRHVMARHKGEKPYQCPHCDYKSANSGDIKRHVMARHTCEKPHLCSHCDYKSADSGDMKKHVMARHTGEKPHQCPYCDYKSAIPGTLKRHVMARHIAQKTHRCPL

Sequence clustering based on sequence similarity using MMseqs2