Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 0.007 17 7.7 0.4 21 48 21 48 16 51 0.89

2 8 0.00025 0.61 12.3 0.4 18 48 47 77 45 80 0.92

3 8 0.00023 0.56 12.4 0.5 18 49 76 107 74 112 0.90

4 8 0.32 7.7e+02 2.4 0.3 18 40 105 127 104 136 0.71

5 8 0.0029 6.9 8.9 0.1 21 49 137 165 123 169 0.88

6 8 0.032 77 5.6 0.3 18 45 163 190 161 196 0.82

7 8 0.039 94 5.3 0.1 22 48 196 222 192 224 0.85

8 8 0.0019 4.7 9.5 0.6 18 48 221 251 219 254 0.89

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	0.007	17	7.7	0.4	21	48	21	48	16	51	0.89
2	8	0.00025	0.61	12.3	0.4	18	48	47	77	45	80	0.92
3	8	0.00023	0.56	12.4	0.5	18	49	76	107	74	112	0.90
4	8	0.32	7.7e+02	2.4	0.3	18	40	105	127	104	136	0.71
5	8	0.0029	6.9	8.9	0.1	21	49	137	165	123	169	0.88
6	8	0.032	77	5.6	0.3	18	45	163	190	161	196	0.82
7	8	0.039	94	5.3	0.1	22	48	196	222	192	224	0.85
8	8	0.0019	4.7	9.5	0.6	18	48	221	251	219	254	0.89

Coding Sequence: ATGACAGATATATTTGAAGATCATCAGCGCAGACATGGATATGAAAATAACTaccatacaggtgagaagcctcatcaatgtcctcactgtgattataaatcagcaagaTCTGGATCTATTAAAAGGCATATAATGAatcgtcatacaggtgagaagcctcatcaatgtcctcactgtgattataaatcatcaCAATCTGGAAGTATTAAAAggcatataatggctcgtcatacaggtgaaaagccttatcaatgtcctcactgtgattataaatcagcacaatctggagctattaaaaggcatataatggctcgccatacaggtgagaagcctcatcaatgtcctcactgtgattataaatcagcgaACTCTGGAACTATGAAAATGCATGTAATGGCCCTTCATataggtgagaagcctcatcagtGTCCTcaatgtgattataaatcagcaagaTCTGGAGATATAAAAAGACATGttatggcccgtcatacaggtgagaagcctcatcagtgtcctcactgtgattataaatcagcaagaTCTGGAGGAATAAAAAGACATGTAATGGCCCTTCATACAGGTGAGAACTCTCATCAGTGTCCatactgtgattataaatcagtaaAATCTGAAACTATGAAAAGACATGttatggcccgtcatacaggtgagaagcctcatcagtgtcctcactgtgattataaatcagcaagaTCTGGAGATATAAAAAGACATGTTATGGCCCGTCATAACATTCCGTGGAGGGCTTGA
Protein Sequence: MTDIFEDHQRRHGYENNYHTGEKPHQCPHCDYKSARSGSIKRHIMNRHTGEKPHQCPHCDYKSSQSGSIKRHIMARHTGEKPYQCPHCDYKSAQSGAIKRHIMARHTGEKPHQCPHCDYKSANSGTMKMHVMALHIGEKPHQCPQCDYKSARSGDIKRHVMARHTGEKPHQCPHCDYKSARSGGIKRHVMALHTGENSHQCPYCDYKSVKSETMKRHVMARHTGEKPHQCPHCDYKSARSGDIKRHVMARHNIPWRA

Sequence clustering based on sequence similarity using MMseqs2