Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 3.7 8.9e+03 -1.0 0.4 23 46 45 68 31 75 0.63

2 9 0.024 58 6.0 0.7 17 49 97 129 88 133 0.85

3 9 0.042 1e+02 5.2 0.6 18 48 127 157 126 158 0.88

4 9 0.00021 0.51 12.5 1.0 17 49 155 187 151 192 0.92

5 9 0.13 3.1e+02 3.6 0.3 18 48 185 215 183 218 0.80

6 9 0.00094 2.3 10.5 0.1 17 48 213 244 204 245 0.93

7 9 0.003 7.2 8.8 0.3 17 48 242 273 240 276 0.93

8 9 0.0031 7.4 8.8 0.2 18 48 272 302 271 304 0.92

9 9 5.5e-06 0.013 17.6 0.6 18 49 301 332 300 335 0.91

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	3.7	8.9e+03	-1.0	0.4	23	46	45	68	31	75	0.63
2	9	0.024	58	6.0	0.7	17	49	97	129	88	133	0.85
3	9	0.042	1e+02	5.2	0.6	18	48	127	157	126	158	0.88
4	9	0.00021	0.51	12.5	1.0	17	49	155	187	151	192	0.92
5	9	0.13	3.1e+02	3.6	0.3	18	48	185	215	183	218	0.80
6	9	0.00094	2.3	10.5	0.1	17	48	213	244	204	245	0.93
7	9	0.003	7.2	8.8	0.3	17	48	242	273	240	276	0.93
8	9	0.0031	7.4	8.8	0.2	18	48	272	302	271	304	0.92
9	9	5.5e-06	0.013	17.6	0.6	18	49	301	332	300	335	0.91

Coding Sequence: atGTTATTGCTTAAAGGTGCCAATAATAGTTGCCATAAACTTCAGAAGTCTCTTCAATaccctcattgtgactataaatcCGTACGATTTGGACATGAGAAACGTCATATAGAAGGTCATCATACTAgtgagaagtcctatcaatgTCTTCATTGTGATTTTAAGTCAGTGGAATTAGGAAATTTGAAAAGACATATAATGACCTTTCATACTAAAGAGAAACCTCATCAATACCCTCATTGTTCTTATAaatctgtgggatctggagcTGTGAAACAACATGTTAGGGACCATCGtgcaggtgagaagcctcatcaatgtcctcactgtgattataaatcagcacaagctggatgtataaaaaaacatattttggcCCGGCATACAGGAGAGAAGCCCCAcaaatgtcctcactgtgattataaatcagtacAATCtggacaaattaaaatacatgtAATATCTCGGCACAAAAGTGAGAAGCCccatcaatgccctcattgtgattataaatcagcacaatcTGGACATATGAAAATACATGTCATGGCCCGTCAtgcaggtgagaagcctcatcaatgtcctcactgtgattataaatcagcacgaTCTGGAGTTATGAAAATACATGTAATGGCCCGGCACAAAGGTGAGAAGCCatatcaatgtcctcattgtgattataaatcaacacaatctggaaatatgaaaatacatgtaaTATCCCGGCACAAAGGTGAAAAGCcgcatcaatgtcctcattgtgattttAAATCAGTACAATCTGGACATatgaaaatacatataattgcccggcatacaggtgagaagccccATCAATGTCCGCagtgtgattataaatcagcacaatctggagctatgaaaatacatttaatgGCTCGTCATGCAGgcgagaagcctcatcaatgtcctcactgtgattatagatcagcacaatctggaaatttgaaaaaacatcTTATGGTCAGGCATACAAGTGAAAAGTCTTaa
Protein Sequence: MLLLKGANNSCHKLQKSLQYPHCDYKSVRFGHEKRHIEGHHTSEKSYQCLHCDFKSVELGNLKRHIMTFHTKEKPHQYPHCSYKSVGSGAVKQHVRDHRAGEKPHQCPHCDYKSAQAGCIKKHILARHTGEKPHKCPHCDYKSVQSGQIKIHVISRHKSEKPHQCPHCDYKSAQSGHMKIHVMARHAGEKPHQCPHCDYKSARSGVMKIHVMARHKGEKPYQCPHCDYKSTQSGNMKIHVISRHKGEKPHQCPHCDFKSVQSGHMKIHIIARHTGEKPHQCPQCDYKSAQSGAMKIHLMARHAGEKPHQCPHCDYRSAQSGNLKKHLMVRHTSEKS

Sequence clustering based on sequence similarity using MMseqs2