Acus000819.1
Basic Information
- Insect
- Arma custos
- Gene Symbol
- -
- Assembly
- GCA_037127475.1
- Location
- CM073759.1:12204659-12205765[-]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 12 0.0019 4.5 9.5 0.5 21 49 11 39 5 43 0.90 2 12 0.0064 15 7.8 0.5 18 49 37 68 36 73 0.86 3 12 0.94 2.3e+03 0.8 0.2 18 51 66 99 64 102 0.83 4 12 0.0016 3.7 9.8 0.5 26 49 103 126 98 130 0.86 5 12 0.092 2.2e+02 4.1 0.5 17 31 123 137 122 154 0.82 6 12 0.014 34 6.7 0.1 23 47 158 182 151 185 0.84 7 12 0.0013 3.1 10.0 0.1 21 48 185 212 180 216 0.90 8 12 1 2.4e+03 0.8 0.0 26 48 219 241 213 246 0.80 9 12 0.091 2.2e+02 4.1 0.1 21 48 243 270 239 273 0.81 10 12 0.014 35 6.7 0.5 18 48 269 299 267 302 0.88 11 12 0.0011 2.8 10.2 0.3 18 48 298 328 297 330 0.91 12 12 0.038 92 5.3 0.2 18 48 327 357 326 361 0.87
Sequence Information
- Coding Sequence
- ATGAAAAATCATATCCAAGCTCATCATAcgggtgagaagcctcatcaatgccctcattgtgatcatcaatctgtaacatctggaaatatgaaaaaacatatacaacgtcgtcataccggtgagaagccttttcaatgtcctcattgtgattataaatctgtagcatctggaagtttgaaaaaacatatacaacatcgtcataccggtgagaagccTTTTCAATGtactcattgtgattataaatctgtaacatctgtaCAATTGAAATACCATATACAAGCTCATCATACGGGTAAAaagtcctatcaatgccctcattgcgATTATAAATCTACAACATTTAGAAATTTGAAAAGACAtttaatggcccgtcatacaagtgagaagcctcatcaatgtcctcattgtgattataaatctgtggAATCAGGAGCTATGAAAATACACTACATGGCCTGGCACAAAGGTGAGAAGCTatatcaatgtcctcattgtgatcaTAAATCAACACAATCTGGAAATTTGAGAACACATGTAATGGCCTAtcatactggtgagaagccttttcaatgccctcattgtgattataaatctgtacaatctggaaatatgaaaaaacatgtaagggtccatcatactggtgagaagctgtttcaatgccctcattgtgattataaatctgtaacatctggaaatatgaaaaaacatgtaatggcccatcatactggtgagaagccttttcaatgccctcattgtgattataaatctataaaatctGGAGATGTGAAAAACcatgtaatggcccgtcatactggtgagaagccttttcaatgccctcattgtgattataaatctgtacattCTGGAcatatgaaaaaacatatacaacatcgtcatactggtgagaagccttttcaatgtcctcattgtgattataaatttgtaacatctggaaatatgaaaaaacatatacaacgtcgtcataccggtgagaagccttttcaatgtcctcattgtgattataaatctgtaacatctggagaaatgaaaaatcatgtacaagctcgtcataccggtgagaagtcctTATCAGTGCCCTCATTGTGA
- Protein Sequence
- MKNHIQAHHTGEKPHQCPHCDHQSVTSGNMKKHIQRRHTGEKPFQCPHCDYKSVASGSLKKHIQHRHTGEKPFQCTHCDYKSVTSVQLKYHIQAHHTGKKSYQCPHCDYKSTTFRNLKRHLMARHTSEKPHQCPHCDYKSVESGAMKIHYMAWHKGEKLYQCPHCDHKSTQSGNLRTHVMAYHTGEKPFQCPHCDYKSVQSGNMKKHVRVHHTGEKLFQCPHCDYKSVTSGNMKKHVMAHHTGEKPFQCPHCDYKSIKSGDVKNHVMARHTGEKPFQCPHCDYKSVHSGHMKKHIQHRHTGEKPFQCPHCDYKFVTSGNMKKHIQRRHTGEKPFQCPHCDYKSVTSGEMKNHVQARHTGEKSLSVPSL
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00165415;
- 90% Identity
- iTF_00165415;
- 80% Identity
- iTF_00165415;