Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 10 4e-05 0.097 14.8 0.5 21 48 6 33 3 35 0.93

2 10 0.0033 7.9 8.7 0.5 18 49 32 63 30 68 0.89

3 10 0.63 1.5e+03 1.4 0.6 18 31 61 74 59 92 0.81

4 10 0.021 52 6.1 0.2 21 48 93 120 80 123 0.90

5 10 0.0016 3.8 9.7 0.2 18 49 119 150 117 154 0.90

6 10 0.02 47 6.2 0.2 18 48 148 178 146 180 0.90

7 10 0.00076 1.8 10.8 0.1 17 48 176 207 163 211 0.86

8 10 0.068 1.6e+02 4.5 0.4 18 48 206 236 204 238 0.81

9 10 9.7e-05 0.23 13.6 0.2 17 48 234 265 229 268 0.91

10 10 0.0015 3.6 9.8 0.3 18 49 264 295 263 301 0.89

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	10	4e-05	0.097	14.8	0.5	21	48	6	33	3	35	0.93
2	10	0.0033	7.9	8.7	0.5	18	49	32	63	30	68	0.89
3	10	0.63	1.5e+03	1.4	0.6	18	31	61	74	59	92	0.81
4	10	0.021	52	6.1	0.2	21	48	93	120	80	123	0.90
5	10	0.0016	3.8	9.7	0.2	18	49	119	150	117	154	0.90
6	10	0.02	47	6.2	0.2	18	48	148	178	146	180	0.90
7	10	0.00076	1.8	10.8	0.1	17	48	176	207	163	211	0.86
8	10	0.068	1.6e+02	4.5	0.4	18	48	206	236	204	238	0.81
9	10	9.7e-05	0.23	13.6	0.2	17	48	234	265	229	268	0.91
10	10	0.0015	3.6	9.8	0.3	18	49	264	295	263	301	0.89

Coding Sequence: ATGGCctgtcatacaggtgagaagcctcatcactgtcctcactgtgattataaatcagctcAATCTAGAGATATGAAAAGACATGtgatggcccgtcatacaggtgagaagcctcatcactgtcctcactgtgattataaatcagcacaatctggacacatgaaaaatcatgtaatggcccgtcatacaggtgagaagcctcatcaatgtcctcagtgtgattataaatcagccaTATCTGGAACCATGAAAATACATGTAATGGCctgtcatacaggtgagaagcctcatcactgtcctcattgtgattataaatcagcacaatctggagctatgaaaatacatgttatggcccgtcataccggtgagaagcctcatcactgtcctcactgtgattataaatcagcagaaTCTGGAGATATGAAAAGACATGtgatggcccgtcatacaggtgagaagcctcatcactgtcctcactgtgattataaatcagcagaaTCTGGAACTATGAAAAAGCATGTTATGGCccgtcataccggtgagaaacctcatcactgtcctcactgtgattataaatcagcagaaTCTGGAGATATGAAAAGACATGTGATGGCCcgtcatactggtgagaagcctcatcaatgtcctcactgtgattataaatcagtgaACACTGCAACTATGAAAAAACATGTAATGGCCCggcatacaggtgagaagcctcatcactgtcctcactgtgattataaatcagcacaatctggaaatatgaaaaaacatgtTATGGCCCggcatacaggtgagaagcctcatcactgtcctcactgtgattataaatcagcacaatcTGGAACTATGAAAAAACATGTTATGGCCCggcatacaggtgagaagcctcatcaatgtcctcccTAA
Protein Sequence: MACHTGEKPHHCPHCDYKSAQSRDMKRHVMARHTGEKPHHCPHCDYKSAQSGHMKNHVMARHTGEKPHQCPQCDYKSAISGTMKIHVMACHTGEKPHHCPHCDYKSAQSGAMKIHVMARHTGEKPHHCPHCDYKSAESGDMKRHVMARHTGEKPHHCPHCDYKSAESGTMKKHVMARHTGEKPHHCPHCDYKSAESGDMKRHVMARHTGEKPHQCPHCDYKSVNTATMKKHVMARHTGEKPHHCPHCDYKSAQSGNMKKHVMARHTGEKPHHCPHCDYKSAQSGTMKKHVMARHTGEKPHQCPP

Sequence clustering based on sequence similarity using MMseqs2