Agra017297.1
Basic Information
- Insect
- Arctopsyche grandis
- Gene Symbol
- -
- Assembly
- GCA_029955255.1
- Location
- JARCGT010000059.1:842740-843478[+]
Transcription Factor Domain
- TF Family
- AF-4
- Domain
- AF-4 domain
- PFAM
- PF05110
- TF Group
- Unclassified Structure
- Description
- This family consists of AF4 (Proto-oncogene AF4) and FMR2 (Fragile X syndrome) nuclear proteins. These proteins have been linked to human diseases such as acute lymphoblastic leukaemia and mental disabilities [1]. The family also contains a Drosophila AF4 protein homologue Lilliputian which contains an AT-hook domain. Lilliputian represents a novel pair-rule gene that acts in cytoskeleton regulation, segmentation and morphogenesis in Drosophila [2].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 5.2e-09 1.2e-05 25.4 0.0 23 78 40 93 35 102 0.82
Sequence Information
- Coding Sequence
- ATGGAGCAATACGCCAAATGGTGTCGCCAGTTGCTCAGAGAAGAGAAGCGCAAACACAAAAAACCCACTGGAGTCCCACTGGATAATAAATACGCAAAATTCGTTAAACGAGAGCAGATGTCCTCGAAAGGGTCGGAATGCGTGCCTTTGTTTGGCCCGCCAGTTAAAGTAAAGCCGGACCGAGAAGCCCAGCAAATACAGAGCAAATTAGGTGACTTCGATACTGTTAAACATCTACTTAACCAATCTTCTCTCGGCGTATATGACGAGCCTGCTAGCCCAGCTCCAGGCGGGTGGGTCTTCTCAAATTGGCGAATCTAA
- Protein Sequence
- MEQYAKWCRQLLREEKRKHKKPTGVPLDNKYAKFVKREQMSSKGSECVPLFGPPVKVKPDREAQQIQSKLGDFDTVKHLLNQSSLGVYDEPASPAPGGWVFSNWRI
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -