Adep025677.1
Basic Information
- Insect
- Aradus depressus
- Gene Symbol
- -
- Assembly
- GCA_963662175.1
- Location
- OY759219.1:16711650-16721378[-]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 3 0.014 63 5.2 0.1 25 48 32 55 26 57 0.92 2 3 1.7e-05 0.077 14.6 0.3 27 48 100 121 95 124 0.94 3 3 6.5e-05 0.29 12.7 0.3 22 48 125 151 122 154 0.90
Sequence Information
- Coding Sequence
- ATGGTTTGTGGATTTTTCGAATTAATTGCTCGGATGGACGATTATGTCAACCGTAAAATGGACGTATCGCATGGATCCCATCTGGCACTTGTAGGGACCTGCCCCCATTGCGGTGCCAAGTACAACAACCAATCAGCTCTCAAATACCATGTCCGCCTCATGCACTCTGACCTGACCAATACTCTCTGTTGTTATCTCTGTCCCAAGTCCTTCGGGTCCCGTGACACCTACAAGGTTCATATGTGGCTCTCTCATAGGCGTATCGTCgaagGTGGAGATAGAAATGGACGAAGACCCTGTCCATTGTGTACTAAAGTTATATCCAACAAGTCAAATTTACTGAAACACATGAGGATCCGCCATAGTGATCAGTACAATCCGGCCTGCTGTGTCCTGTGCAACAAAGTGTTCAAAAATAAGTACAGTCTCCGAGCTCATCTGAACATTTACCATAAGGAGTACATCTCATCTCCGGTGTCGACCCAGCCTCAGCCACCCCCACCCCAACCTCAGCAGCTCATGGAGGTTATTCCCCAGTACCTCCCCACGgtttaa
- Protein Sequence
- MVCGFFELIARMDDYVNRKMDVSHGSHLALVGTCPHCGAKYNNQSALKYHVRLMHSDLTNTLCCYLCPKSFGSRDTYKVHMWLSHRRIVEGGDRNGRRPCPLCTKVISNKSNLLKHMRIRHSDQYNPACCVLCNKVFKNKYSLRAHLNIYHKEYISSPVSTQPQPPPPQPQQLMEVIPQYLPTV
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00154811;
- 90% Identity
- iTF_00154811;
- 80% Identity
- iTF_00154811;