Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.019 87 4.8 0.0 18 43 43 68 36 78 0.88

2 6 0.27 1.2e+03 1.1 0.1 26 44 79 97 73 101 0.87

3 6 0.00055 2.5 9.7 0.2 21 46 102 127 98 134 0.86

4 6 0.1 4.6e+02 2.4 0.2 21 48 130 157 126 161 0.81

5 6 2.6e-05 0.12 14.0 0.0 22 51 159 188 156 189 0.87

6 6 1.8e-06 0.0083 17.6 0.2 21 49 186 214 184 215 0.93

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.019	87	4.8	0.0	18	43	43	68	36	78	0.88
2	6	0.27	1.2e+03	1.1	0.1	26	44	79	97	73	101	0.87
3	6	0.00055	2.5	9.7	0.2	21	46	102	127	98	134	0.86
4	6	0.1	4.6e+02	2.4	0.2	21	48	130	157	126	161	0.81
5	6	2.6e-05	0.12	14.0	0.0	22	51	159	188	156	189	0.87
6	6	1.8e-06	0.0083	17.6	0.2	21	49	186	214	184	215	0.93

Coding Sequence: ATGAAGAGTATAGATGAGAAACATTTTCAATATTCTAACACTTTGGAAAGCGATTCGCAGCTCATCAAAGAGAAGACCTTCCAGTGTACGTTGTGTGGTTACTGCTGCAGTCAAACCGGTATTTTGAGGAACACAGACGAGAAACCTTTTGTTTGGTCAATATGTAACTATAGTTGTAGATTTTCTTGGAATCTCAAGAGTCACAAATTGACACACACGGAAGGAAAAGCTTTCCATTGTTCAGTATGTAGTTTCAGGTTTCGACATTATAGCAATCTGAAAAGTCATATGTTAACTCATAACGATGAGAAACCCCACCAATGTACGCTATGTAACTTTAGAAGTCGACAAGCGGGCAGTTTGAAGAGACATATAAGGACACACACAGAGGAGAAACCTTTTCATTGTACAAATTGTACCTTTAAATGTCAACGAAATGGTTCTTTGAAAAGACACATGGCTGTACATACGGGAGACAAACCATTTGAATGTCCTGTATGTGATTATACATGTCGACAATCTGCTGGTTTGAAGAGTCACATGATGTTACACTCAGAGGAAAAACCATTCCAATGTACGATATGTAACCACACATCTCGACAGTCAGGAGGTTTGAAGAGACATCACATGTTGAAGCACTTGGAGTGA
Protein Sequence: MKSIDEKHFQYSNTLESDSQLIKEKTFQCTLCGYCCSQTGILRNTDEKPFVWSICNYSCRFSWNLKSHKLTHTEGKAFHCSVCSFRFRHYSNLKSHMLTHNDEKPHQCTLCNFRSRQAGSLKRHIRTHTEEKPFHCTNCTFKCQRNGSLKRHMAVHTGDKPFECPVCDYTCRQSAGLKSHMMLHSEEKPFQCTICNHTSRQSGGLKRHHMLKHLE

Sequence clustering based on sequence similarity using MMseqs2