Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.0001 0.47 12.0 0.7 21 44 10 33 6 42 0.86

2 6 0.5 2.2e+03 0.3 0.2 23 44 40 61 36 68 0.84

3 6 0.00046 2.1 10.0 1.6 22 44 67 89 48 93 0.82

4 6 0.00021 0.95 11.0 0.2 21 47 94 120 90 125 0.86

5 6 0.00054 2.4 9.8 0.5 22 44 123 145 120 150 0.89

6 6 7.4e-06 0.033 15.7 0.2 21 46 150 175 147 179 0.90

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.0001	0.47	12.0	0.7	21	44	10	33	6	42	0.86
2	6	0.5	2.2e+03	0.3	0.2	23	44	40	61	36	68	0.84
3	6	0.00046	2.1	10.0	1.6	22	44	67	89	48	93	0.82
4	6	0.00021	0.95	11.0	0.2	21	47	94	120	90	125	0.86
5	6	0.00054	2.4	9.8	0.5	22	44	123	145	120	150	0.89
6	6	7.4e-06	0.033	15.7	0.2	21	46	150	175	147	179	0.90

Coding Sequence: atgaagaggcatatgttgactCACACTGAGGAGAAGCCGTTCCAGTGTACAATATGCAGTTTTAGATGTCGGCAGTCTTGTAgtttgaagaagcatatgttgacTCACACCGATATTAAACCGTTCCAGTGTTCAGTGTGCAGCTATAGATGTAGGGAGCCCAGCAGTTTAAAGAGTCATATGATGTCTCACACTGATAAGAAACCCTTCCAATGTACAGTGTGCAGTTATAGTTGTCGAGAGTCAAGTAACATGAAGAGGCACATAGTTACTCACACTGACgagaaaccattccaatgtaCAGTGTGCCGTTATAGTTGTCGAGAATCTGGCAAATTGAAGAGACATATGTTGATTCACACTGATGATAAGCCGTTCCAATGTACAGTGTGTAGTTACAGATGTCGAGTGTCTGGcaatttgaagaggcatatgttgactCACACTGAGGAGgaaccgttccaatgttcagTGTGTAGTTATAGATCTCGGCAGTCTGGCAATATGAAGAGACATTTGTTGCTTCATTCTGACAAAGAAGCATAG
Protein Sequence: MKRHMLTHTEEKPFQCTICSFRCRQSCSLKKHMLTHTDIKPFQCSVCSYRCREPSSLKSHMMSHTDKKPFQCTVCSYSCRESSNMKRHIVTHTDEKPFQCTVCRYSCRESGKLKRHMLIHTDDKPFQCTVCSYRCRVSGNLKRHMLTHTEEEPFQCSVCSYRSRQSGNMKRHLLLHSDKEA

Sequence clustering based on sequence similarity using MMseqs2