Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.00024 5.9 9.8 0.1 20 52 5 37 3 39 0.93

2 6 0.001 25 7.7 0.1 19 52 32 65 29 66 0.86

3 6 0.00017 4.2 10.2 0.2 21 52 62 93 58 95 0.89

4 6 0.01 2.4e+02 4.6 0.0 20 52 89 121 87 123 0.89

5 6 0.0031 75 6.2 0.0 20 44 117 141 108 147 0.83

6 6 1.7e-05 0.4 13.5 0.0 21 46 146 171 143 179 0.89

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.00024	5.9	9.8	0.1	20	52	5	37	3	39	0.93
2	6	0.001	25	7.7	0.1	19	52	32	65	29	66	0.86
3	6	0.00017	4.2	10.2	0.2	21	52	62	93	58	95	0.89
4	6	0.01	2.4e+02	4.6	0.0	20	52	89	121	87	123	0.89
5	6	0.0031	75	6.2	0.0	20	44	117	141	108	147	0.83
6	6	1.7e-05	0.4	13.5	0.0	21	46	146	171	143	179	0.89

Coding Sequence: ATGATCATTCACAGCTCGGAAAAGCCGTTTGTTTGCAAAACTTGTGGTTTCTCTGCTCGACGTCACCGTACTTTAAAGGATCACATGTCTAGTCATAGTTCGGCAAAACCGCTTATTTGTGAAACTTGTGGATACACGACTCGAAATCAGTATAATCTAAAAAACCACATGAAGATTCACAGTTCAAAAAAACCATATGCTTGTGAAATTTGTGAGTACTCGACTCGAcattactataatttaaaaaaccacatCACGATTCATAGCTCAGAAAAACCATTTGTTTGTGAAACGTGTGGGTTCTCTACTCGTTATCGGAGTACTCTAAAGGAACATATGGTTATTCACCAGACAGAAAAACCATTGGTTTGTGAAATTTGTGGGTTTTTTACTACATATCGGTCAACTTTAAGGCACCACATGGTTATTCACAGCTCCAAAAAACCATTTGTTTGTGAAACCTGTGGATTCTCTACTCGATATTCCCATAATTTAAGGAAACACATGGAGACTCACGGTCAGGTAAAATCCTTCGTTTGTGGAACTTGTCAGTTCTCTGCTCAACGTAAATTGGATCTAGTTAAGCACATGGTCATTCACAGCTCAAAACGAAACACTGGTTTGTGA
Protein Sequence: MIIHSSEKPFVCKTCGFSARRHRTLKDHMSSHSSAKPLICETCGYTTRNQYNLKNHMKIHSSKKPYACEICEYSTRHYYNLKNHITIHSSEKPFVCETCGFSTRYRSTLKEHMVIHQTEKPLVCEICGFFTTYRSTLRHHMVIHSSKKPFVCETCGFSTRYSHNLRKHMETHGQVKSFVCGTCQFSAQRKLDLVKHMVIHSSKRNTGL

Sequence clustering based on sequence similarity using MMseqs2