Basic Information

Transcription Factor Domain

TF Family: BTB
Domain: zf-C2H2|ZBTB
PFAM: PF00651
TF Group: Zinc-Coordinating Group
Description: The BTB (for BR-C, ttk and bab) [6] or POZ (for Pox virus and Zinc finger) [1] domain is present near the N-terminus of a fraction of zinc finger (Pfam:PF00096) proteins and in proteins that contain the Pfam:PF01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerisation and in some instances heteromeric dimerisation [1]. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule [2]. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT [5, 3, 4]. The POZ or BTB domain is also known as BR-C/Ttk or ZiN.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 0.014 8 8.1 0.0 84 109 5 30 3 31 0.91

2 3 5.4e-17 3e-14 54.6 0.0 9 97 126 214 120 228 0.87

3 3 0.19 1e+02 4.5 0.1 77 107 228 258 217 261 0.83

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	0.014	8	8.1	0.0	84	109	5	30	3	31	0.91
2	3	5.4e-17	3e-14	54.6	0.0	9	97	126	214	120	228	0.87
3	3	0.19	1e+02	4.5	0.1	77	107	228	258	217	261	0.83

Coding Sequence: ATGCTGCTGGTGCTGGAGGTGCTGCGGCTGGCCATGCGCCTCCACATCCCGCGCCTGCGCACGCTGTGCGCGCGCTCCCTCAAGGCCAACCTCTGCTACACCAACGTGCTGCCCGCGCTCACCGCCGCCAGCCGCGCCGGCGTGCGGTGTATCAAGGAGTATTGTCTCAGGTTCGTAGTGAAGGATTACAACTTCACTCCGATCGTGATGTCGAGCGAATTCGAGCAACTCGAGCAATCACTGATGGTAGAAGTAGTGCGTCGGCGGCAGCAACCCACCGCCGCCAAACAGACGCATAGCATCGATAGCGACATCGAACTACAGGGAACAACGCTAGAGCAAGACTTCTGCGTGTTCCTATCGGGCGGCGGCCACGACTTGTCCGACGTGCAGCTGCGGGTGGGGCAGCACATGCGGCCGGGACACCGCTCCATACTGGCCGCTAGAGCTGCCTACTTCGAGGCCATGTTCCGATCCTTCTCACCCGTCGATAATATCGtcaatATCCAGATCTGCGATGTAGTCCCATCGGAGGAGGCTTTCGACTCGATGCTCCGGTACATCTACTACGGAGACACCAACATGCCCACTGAAGACTCGCTCTATCTATTCCAAGCCCCTATTTACTATGGCTTCACCAATAACCGACTGCAGGTATTCTGCAAACACAACCTGCAGAGCAACGTCTCGCAACAGAACGTGCTGGCCACGCTGCAGGCCGCGGACCGCATGCGCACTCCCGACATCAAGGAGTACGCCATCAAGATGGTCATACACCACTTCAAGACGGTGGGCCGCCAAGACGCAATAAAGAACCTCCCGCAATCATTACTAGTGGACATCATTTACGCTTTAGCCGACGACGCAGCAGAGAAAGCAAAAGAACAAGCACAGGACAAAGTACAGCGAGCTTTACAAACGTCTTCGTCAGCTGATTTCTTAAACACGGAATACAGCGATAGTGAATACATGCAGCATAAACAAGGGAAATAG
Protein Sequence: MLLVLEVLRLAMRLHIPRLRTLCARSLKANLCYTNVLPALTAASRAGVRCIKEYCLRFVVKDYNFTPIVMSSEFEQLEQSLMVEVVRRRQQPTAAKQTHSIDSDIELQGTTLEQDFCVFLSGGGHDLSDVQLRVGQHMRPGHRSILAARAAYFEAMFRSFSPVDNIVNIQICDVVPSEEAFDSMLRYIYYGDTNMPTEDSLYLFQAPIYYGFTNNRLQVFCKHNLQSNVSQQNVLATLQAADRMRTPDIKEYAIKMVIHHFKTVGRQDAIKNLPQSLLVDIIYALADDAAEKAKEQAQDKVQRALQTSSSADFLNTEYSDSEYMQHKQGK

Sequence clustering based on sequence similarity using MMseqs2