Atae028199.1


Basic Information
Transcription Factor Domain
Sequence Information
Similer Transcription Factors

Basic Information

Insect
Aproaerema taeniolella
Gene Symbol
bs
Assembly
GCA_949987775.1
Location
OX465256.1:17798278-17798739[-]

Transcription Factor Domain

TF Family
SRF
Domain
SRF domain
PFAM
PF00319
TF Group
Helix-turn-helix
Description
Serum response factor (SRF) is a ubiquitous nuclear protein important for cell proliferation and differentiation. SRF function is essential for transcriptional regulation of numerous growth-factor-inducible genes, such as c-fos oncogene and muscle-specific actin genes. A core domain of around 90 amino acids is sufficient for the activities of DNA-binding, dimerisation and interaction with accessory factors. Within the core is a DNA-binding region, designated the MADS box [2], that is highly similar to many eukaryotic regulatory proteins: among these are MCM1, the regulator of cell type-specific genes in fission yeast; DSRF, a Drosophila trachea development factor; the MEF2 family of myocyte-specific enhancer factors; and the Agamous and Deficiens families of plant homeotic proteins. In SRF, the MADS box has been shown to be involved in DNA-binding and dimerisation [1]. Proteins belonging to the MADS family function as dimers, the primary DNA-binding element of which is an anti-parallel coiled coil of two amphipathic α-helices, one from each subunit. The DNA wraps around the coiled coil allowing the basic N-termini of the helices to fit into the DNA major groove. The chain extending from the helix N-termini reaches over the DNA backbone and penetrates into the minor groove. A 4-stranded, anti-parallel β-sheet packs against the coiled-coil face opposite the DNA and is the central element of the dimerisation interface. The MADS-box domain is commonly found associated with K-box region see (IPR002487).
Hmmscan Out
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc
1 1 1.7e-10 2.2e-06 28.4 0.5 1 23 112 134 112 135 0.95

Sequence Information

Coding Sequence
ATGGACGCGCCCGGCGGAGCGCGCGAGCCCCGCTTCGGGTCGCCCTATGGCATGGGACTGCTAGGAGAGGTGCCGGACATGTACGGGGCCGGCCGCCCGCCTAGCTCGCTCGGCGGCGGCTCCCTCAGACCCGGCATGCAGCCGTGCCCGGTTCCCCGGGGAGTCAAGAGACCTTCCGACCAGTGCTACGATGATCGCCCCTCTCAGAGTCTCGGCTTGGAGCACTGTCCCATGCCGGACATAGCAGACGATGGCTATGCATCACTCCAGCCGAAGAAGTCACCACCGTCCAATGGCAAGAAGACGAAAGGACGTGTCAAAATAAAGATGGAATACATAGATAACAAATTGCGGCGGTACACGACGTTCTCCAAGCGGAAGACTGGCATTATGAAGAAGGTGGGTTGTTGCGGAGACCGCTTTTGGCAATATTCCATGTGGATCGACCACCGAGCCCACTGA
Protein Sequence
MDAPGGAREPRFGSPYGMGLLGEVPDMYGAGRPPSSLGGGSLRPGMQPCPVPRGVKRPSDQCYDDRPSQSLGLEHCPMPDIADDGYASLQPKKSPPSNGKKTKGRVKIKMEYIDNKLRRYTTFSKRKTGIMKKVGCCGDRFWQYSMWIDHRAH

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity
iTF_01545729; iTF_01546627; iTF_01543914; iTF_01544861; iTF_00323490; iTF_01337730; iTF_01463234; iTF_00010054; iTF_00009007; iTF_00744615; iTF_01178543; iTF_00844328; iTF_01561096; iTF_01451434; iTF_01452301; iTF_01453248; iTF_00871271; iTF_00412489; iTF_00680522; iTF_00411441; iTF_00410264; iTF_00772860; iTF_00673483; iTF_01153004; iTF_01359730; iTF_00288027; iTF_01017708; iTF_01018544; iTF_00212443; iTF_01501093; iTF_00275246; iTF_01336823; iTF_00642298; iTF_00994331; iTF_00674272; iTF_01016653; iTF_00155278; iTF_00342180; iTF_00325363; iTF_00156224; iTF_00660291; iTF_00658382; iTF_00657174; iTF_00659423; iTF_00409261; iTF_00896789; iTF_01133708; iTF_00355136; iTF_00654266; iTF_00289594; iTF_01072474; iTF_00656123; iTF_01245917; iTF_00148446; iTF_00149376; iTF_00354063; iTF_01280273; iTF_00364905; iTF_00178138; iTF_00075521; iTF_00709217; iTF_01085217; iTF_00301155; iTF_00723043; iTF_00711844; iTF_01064644; iTF_00774469; iTF_01533029; iTF_01281318; iTF_00404903; iTF_00780999; iTF_00302088; iTF_00445160; iTF_00159817; iTF_00185290; iTF_00458027; iTF_00685419; iTF_00446124; iTF_00778732; iTF_00928684; iTF_01181868; iTF_00186157; iTF_00781805; iTF_00796494; iTF_01377454; iTF_00213424; iTF_00777360; iTF_01061872; iTF_00177105; iTF_01221553; iTF_00042612; iTF_00327060; iTF_00932533; iTF_00736599; iTF_00779480; iTF_00782617; iTF_00457210; iTF_00621210; iTF_01192698; iTF_00041755; iTF_00248059; iTF_00931387; iTF_00985083; iTF_01534811; iTF_00986076; iTF_00775229; iTF_01062781; iTF_01531997; iTF_00040798; iTF_00775998; iTF_01063742; iTF_00247167; iTF_00076512; iTF_00636384; iTF_00776704; iTF_01279235; iTF_01090753; iTF_00720273; iTF_00146403; iTF_00013002; iTF_00651726; iTF_01302318; iTF_00640303; iTF_01220633; iTF_00072797; iTF_01403410; iTF_01282266; iTF_00356178; iTF_00027732; iTF_00026831; iTF_00125108; iTF_00971349; iTF_00970385; iTF_00161526; iTF_00162793; iTF_01021208; iTF_00205100; iTF_01222456; iTF_00715769; iTF_01564634; iTF_00353051; iTF_01438907; iTF_01437962; iTF_00842652; iTF_00420521; iTF_01078185; iTF_01508042; iTF_01506319; iTF_01033713; iTF_00824723; iTF_00418965; iTF_01080695; iTF_00695578; iTF_00843514; iTF_01079038; iTF_01079871; iTF_00795685; iTF_01082420; iTF_00682408; iTF_01547531; iTF_00683341; iTF_01528271; iTF_01529170; iTF_00267164; iTF_01020273; iTF_00461538; iTF_01034567; iTF_00959380; iTF_00419735; iTF_00421339; iTF_01509586; iTF_00166899; iTF_00025223; iTF_00198099; iTF_00737461; iTF_00686324; iTF_00318074; iTF_00632736; iTF_00447126; iTF_00681628; iTF_01334879; iTF_00197342; iTF_00077460; iTF_00777982; iTF_00689376;
90% Identity
iTF_01336823;
80% Identity
-