Anig018506.1
Basic Information
- Insect
- Aporophyla nigra
- Gene Symbol
- -
- Assembly
- GCA_947507805.1
- Location
- OX382299.1:9586700-9588111[+]
Transcription Factor Domain
- TF Family
- zf-LITAF-like
- Domain
- zf-LITAF-like domain
- PFAM
- PF10601
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family display a conserved zinc ribbon structure [3] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS)[2]. The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 4.7e-25 7.4e-22 77.9 14.8 2 70 55 123 54 123 0.97
Sequence Information
- Coding Sequence
- ATGAGTCATCCCTCAAACCCGCCTCCCTATTCGGGTCCCAATCCAGGTCCATATACGGGTCCGTATATGGGTCCAGAACCAGGAATCACAGTGATTCACGTGCAGCCAGCGCCAGCACACTACGTCACATCTCCAGTGCTGGTTGGTCAGCCAGTGGGTTCAGAGCCCGCGCTGATCGTCTGCCAGTCCTGTCGTCATCAGATTGTAACAAATATTGAAGTCCGTCCTTCAGTAAGGACGCATCTTTGGGCAATCTGTCTCCTTGTCATAGGATGCTGGCCCTGTATGTGCATACCCTACTGTACACCTGCTTGCATGAACGTGGACCACTACTGCCCCAACTGCAACGCGTTCGTCGGAAAATATCATAATTAG
- Protein Sequence
- MSHPSNPPPYSGPNPGPYTGPYMGPEPGITVIHVQPAPAHYVTSPVLVGQPVGSEPALIVCQSCRHQIVTNIEVRPSVRTHLWAICLLVIGCWPCMCIPYCTPACMNVDHYCPNCNAFVGKYHN
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00112194; iTF_00300834; iTF_00974306; iTF_00426022; iTF_00037447; iTF_00364583; iTF_00906727; iTF_00623688; iTF_01527944; iTF_00123017; iTF_01441610; iTF_00953197; iTF_00071982; iTF_00668110; iTF_00746384; iTF_00758832; iTF_00374834; iTF_00726994; iTF_01247730; iTF_01440658; iTF_00124851; iTF_00039445; iTF_00908469; iTF_01094582; iTF_00038361; iTF_00831803; iTF_01118907; iTF_00123901; iTF_00907549; iTF_01065227; iTF_01093710; iTF_00122022; iTF_01095528; iTF_00375934; iTF_01063420; iTF_01534467; iTF_00446788; iTF_00301769; iTF_01533613; iTF_01064303; iTF_00712528; iTF_01535504; iTF_00445781; iTF_00686007; iTF_00447838; iTF_01062430;
- 90% Identity
- iTF_01095528;
- 80% Identity
- -