Basic Information

Transcription Factor Domain

TF Family: BTB
Domain: zf-C2H2|ZBTB
PFAM: PF00651
TF Group: Zinc-Coordinating Group
Description: The BTB (for BR-C, ttk and bab) [6] or POZ (for Pox virus and Zinc finger) [1] domain is present near the N-terminus of a fraction of zinc finger (Pfam:PF00096) proteins and in proteins that contain the Pfam:PF01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerisation and in some instances heteromeric dimerisation [1]. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule [2]. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT [5, 3, 4]. The POZ or BTB domain is also known as BR-C/Ttk or ZiN.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 1.2e-23 2.5e-21 75.7 0.0 5 106 3 105 1 109 0.89

2 3 0.065 13 5.8 0.0 78 108 109 139 106 141 0.86

3 3 0.082 16 5.5 0.0 82 110 162 190 143 190 0.88

#	of	c-Evalue	i-Evalue	score	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	1.2e-23	2.5e-21	75.7	5	106	3	105	1	109	0.89
2	3	0.065	13	5.8	78	108	109	139	106	141	0.86
3	3	0.082	16	5.5	82	110	162	190	143	190	0.88

Coding Sequence: ATGCTTCTGCGAACTGGCGTCTACAGCGACGTCAGGTTCAAGGTCGGTGAGCGGACTTTTCCCGCGCACAAACACCTGCTGAGCTCGAGCAGTCCGGTGTTCCAAGCGATGTTCGCTCACGGCCAGGTTTTTCCCGAAAATCGCACCAATGGTACCGTCGTCATCGATGATCTAGATCCCGATGTGATCGAACAGCTGCTCACCCACATCTACACCGGTAGAGCTCCAAAGCTCGGTTCGATGCCGCGCGCACTCTTCGTGGCAGCGCACAGGTACGAGCTTGCGGAGTTGCAGCGAGCTTGCCAGGAATTCTTCGTTTTTCGATTGAATCGAGAAAACGTCGTCGAAATTCTCGAGCTCTGCGAGCTTTACGAGTTGAGGGAACTACGCGAGAGAGCGATGGGATTCATCCGAAATCACGAGGCAGACATGGTTCTGGAGCAGAGTTTTCGGAGCTTTTTATGTAGAAACTTCAGGCTCGATGGCATTGCGGAGACTCTCAGGATTTCTCTTAAATACCAAATGGAAGAAGTCAAGGCGGAGGCAATGGAATTTGTTAAGCAGCACAGTAAGGATTTGGCTACGTGCGAGGAGTTTTTGGGACTTTTTCGTACGCATCCGGATTTAATGAGAGAGATTTTTGTTTATGTGCACCGATGA
Protein Sequence: MLLRTGVYSDVRFKVGERTFPAHKHLLSSSSPVFQAMFAHGQVFPENRTNGTVVIDDLDPDVIEQLLTHIYTGRAPKLGSMPRALFVAAHRYELAELQRACQEFFVFRLNRENVVEILELCELYELRELRERAMGFIRNHEADMVLEQSFRSFLCRNFRLDGIAETLRISLKYQMEEVKAEAMEFVKQHSKDLATCEEFLGLFRTHPDLMREIFVYVHR

Sequence clustering based on sequence similarity using MMseqs2