Agly003469.1
Basic Information
- Insect
- Aphis glycines
- Gene Symbol
- -
- Assembly
- GCA_009928515.1
- Location
- scaffold:198443-199767[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 5 0.00038 1.5 9.2 0.1 21 45 22 46 16 53 0.85 2 5 0.058 2.3e+02 2.1 0.2 21 43 50 72 46 77 0.78 3 5 0.00017 0.66 10.3 0.1 20 45 77 102 70 105 0.88 4 5 0.0061 24 5.3 0.0 21 45 106 130 102 133 0.90 5 5 0.0048 19 5.6 0.1 21 43 134 156 129 160 0.88
Sequence Information
- Coding Sequence
- ATGAATCTAAGATTAGTACGGTTTGAGATAATTTACATAATTTTAACCCAACGAACTCATGCAAGAGAAAAGCCATACCAGTGTGATGTGTGTGTTAAATCATATTCTCAAAAATATAATCTAAAAGAACACCTTCGAAGTCATACTGGAGAAAAGCCATACCAGTGTGATGTATGTGATAAATCATTTGCTCGAAATTTTACTCTAAGAGAACACCGTCGAGTTCACGCAGGAGAAAAGCCATACCAGTGTGATATGTGTGATAAATTATTTTCTCAAAAAAGTAATCTAAAACAACACCTTCGAAATCATACTGGAGAAAAGCCATACCAATGTGATGTGTGTGATAAATCATTTTCTCAAAAAAGTCATCTAAAAGAACACCTTCGAACTCATACGGAAGAAAAACCATATCAATGTGATGTATGTGATAAATCGTTTACTCAAAGCAGTCATATGATACGTCATCAGCGAACTCACTCAGGTTAA
- Protein Sequence
- MNLRLVRFEIIYIILTQRTHAREKPYQCDVCVKSYSQKYNLKEHLRSHTGEKPYQCDVCDKSFARNFTLREHRRVHAGEKPYQCDMCDKLFSQKSNLKQHLRNHTGEKPYQCDVCDKSFSQKSHLKEHLRTHTEEKPYQCDVCDKSFTQSSHMIRHQRTHSG
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00135576; iTF_00135615;
- 90% Identity
- iTF_00135576; iTF_00135615;
- 80% Identity
- iTF_00135576; iTF_00135615;