Aobl001801.1
Basic Information
- Insect
- Aphidecta obliterata
- Gene Symbol
- -
- Assembly
- GCA_963966015.1
- Location
- OZ014427.1:22660260-22660971[-]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 5 0.094 3.5e+02 1.9 0.0 26 44 28 46 15 51 0.86 2 5 0.0022 8.3 7.1 0.0 22 45 52 75 47 81 0.90 3 5 0.0021 7.6 7.3 0.1 25 46 83 104 75 106 0.87 4 5 0.00033 1.2 9.8 0.0 21 47 107 133 103 137 0.91 5 5 0.5 1.8e+03 -0.4 0.0 26 43 171 188 157 192 0.74
Sequence Information
- Coding Sequence
- ATGCATACGCCATATTTCAGTATCCGTTTTAGCGTCAGGaagaagaaaaaattcaagagaaaTTGTCCTACTTCCAAATTCAATTGTGCTGTTTGTGATAGAGACTTTACTCAGAAAGGGAATTTGTTACGTCACTATCAAACGCACACAGGAGATAGACCCTTTGCTTGTAAATTGTGTGGAAGCCGCTTCTCACAGAAATCAAATCTACAAAAACATCTTGCTACACATAATGGAGACAAGAGGGTCGAATGTGGAGTTTGCCATAAAGCTTTTGTGCAGAAAGCTAATCTCATCCGACATTTGAGAGTTCATACAGGTGAAAAGCCGTTTGCCTGTGATTTGTGTGGCCATAGGTTCACCCAAAAAGCGAACCTGAAAAAGCATATGCAACTGCATACAACAACAACAGAAACTGGATGTGACACAGCTAAGATGAGATATGAAACTAGTGCTCACACCTGCGATAAATTTCCCAATCAACCAGAAAAagtggaacaaaatgtaaaccTTTGCGATGAATGTCCTGCTACATTCAAAACTAAACGAGCACTCCTCAAGCATAAAAAATACCATAAGTGA
- Protein Sequence
- MHTPYFSIRFSVRKKKKFKRNCPTSKFNCAVCDRDFTQKGNLLRHYQTHTGDRPFACKLCGSRFSQKSNLQKHLATHNGDKRVECGVCHKAFVQKANLIRHLRVHTGEKPFACDLCGHRFTQKANLKKHMQLHTTTTETGCDTAKMRYETSAHTCDKFPNQPEKVEQNVNLCDECPATFKTKRALLKHKKYHK
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00130783;
- 90% Identity
- iTF_00130783;
- 80% Identity
- iTF_00130783;