Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 1.5 1.6e+04 -3.1 0.0 13 21 24 32 21 37 0.70

2 5 0.0032 35 5.5 0.2 22 49 47 74 42 77 0.86

3 5 6.9e-06 0.075 14.0 0.0 21 52 74 105 72 106 0.89

4 5 0.0061 67 4.6 0.0 21 46 102 127 100 130 0.91

5 5 7.2e-05 0.79 10.7 0.1 21 47 130 156 128 161 0.89

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	1.5	1.6e+04	-3.1	0.0	13	21	24	32	21	37	0.70
2	5	0.0032	35	5.5	0.2	22	49	47	74	42	77	0.86
3	5	6.9e-06	0.075	14.0	0.0	21	52	74	105	72	106	0.89
4	5	0.0061	67	4.6	0.0	21	46	102	127	100	130	0.91
5	5	7.2e-05	0.79	10.7	0.1	21	47	130	156	128	161	0.89

Coding Sequence: ATGACAGAATTTCAAGTTACAATTGATACAAAAGATTTCCAAAATAATTTGGAATCATCATCAACTGAAGAGGATCCAATGTCACGTGCATTAAGCCGTACAACAACAGTAACTGTATCAGTACCAAATCAACCAATTGAAAAGCCATTTCAATGTAACGTATGTGAAAGAAGATTTCGTCAATTAAGTACATTGACAAATCATGTTAAAATACATACTGGtgagaaaccatttaaatgtaatatatgtGAAAAGAATTTTCGTCAATCAAGTACATTAAcaaatcatttaaaaattcatactGGTGAGAAACCATTTAATTGTCAATATTGTGGTAAACAATTTCGTCAACTAAGTACATTAAcaaatcatttaaaaattcatactGGTGAAAAACCATTTGAATGTGCCGTCTGTAAAAAACAGTTCCGTCAATCCAGTACATTGaataatcatataaaaattcatgttatggataaattatatttaccatttgaaataaaaacagaaGAGGAGGGATGA
Protein Sequence: MTEFQVTIDTKDFQNNLESSSTEEDPMSRALSRTTTVTVSVPNQPIEKPFQCNVCERRFRQLSTLTNHVKIHTGEKPFKCNICEKNFRQSSTLTNHLKIHTGEKPFNCQYCGKQFRQLSTLTNHLKIHTGEKPFECAVCKKQFRQSSTLNNHIKIHVMDKLYLPFEIKTEEEG

Sequence clustering based on sequence similarity using MMseqs2