Aant013996.1
Basic Information
- Insect
- Anthrax anthrax
- Gene Symbol
- HmgZ_1
- Assembly
- GCA_963971155.1
- Location
- OZ020118.1:8345349-8345765[+]
Transcription Factor Domain
- TF Family
- HMG
- Domain
- HMG_box domain
- PFAM
- PF00505
- TF Group
- Other Alpha-Helix Group
- Description
- High mobility group (HMG) box domains are involved in binding DNA, and may be involved in protein-protein interactions as well. The structure of the HMG-box domain consists of three helices in an irregular array. HMG-box domains are found in one or more copies in HMG-box proteins, which form a large, diverse family involved in the regulation of DNA-dependent processes such as transcription, replication, and strand repair, all of which require the bending and unwinding of chromatin. Many of these proteins are regulators of gene expression. HMG-box proteins are found in a variety of eukaryotic organisms, and can be broadly divided into two groups, based on sequence-dependent and sequence-independent DNA recognition; the former usually contain one HMG-box motif, while the latter can contain multiple HMG-box motifs. HMG-box domains can be found in single or multiple copies in the following protein classes: HMG1 and HMG2 non-histone components of chromatin; SRY (sex determining region Y protein) involved in differential gonadogenesis; the SOX family of transcription factors [1]; sequence-specific LEF1 (lymphoid enhancer binding factor 1) and TCF-1 (T-cell factor 1) involved in regulation of organogenesis and thymocyte differentiation [2]; structure-specific recognition protein SSRP involved in transcription and replication; MTF1 mitochondrial transcription factor; nucleolar transcription factors UBF 1/2 (upstream binding factor) involved in transcription by RNA polymerase I; Abf2 yeast ARS-binding factor [3]; yeast transcription factors lxr1, Rox1, Nhp6b and Spp41; mating type proteins (MAT) involved in the sexual reproduction of fungi [4]; and the YABBY plant-specific transcription factors.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 1.6e-24 2e-21 77.0 3.8 1 69 5 71 5 71 0.99
Sequence Information
- Coding Sequence
- atgtcaGAAAGACCGAAACGACCACTTTCAGCCTATATGTTATGGCTTAGCGAAAATCGTGAAAAGATAAAGAAGGAAAGTCCTGGAATAAAAGTAACAGAAATTGCTAAAAGAGGCGGTGAATTATGGAGAGGAATGAAGGATAAATCTGAATGGGAAGCAAAAGCCGCAAAAATGAAAGATGAATACACAAAAGCCGTTAAAGAATATGAAGCAAATGGTGGAACAGACACTGGTAATAAAAAACGAGGTAAACAATCAAAGAAACCCGCcaaaaaaagcaaaaagaaaGAGGAGTCTGAAGAtgatgaagaagaagaaagcgaataa
- Protein Sequence
- MSERPKRPLSAYMLWLSENREKIKKESPGIKVTEIAKRGGELWRGMKDKSEWEAKAAKMKDEYTKAVKEYEANGGTDTGNKKRGKQSKKPAKKSKKKEESEDDEEEESE
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01518961; iTF_01088322; iTF_00322435; iTF_00999558; iTF_00812739; iTF_01375812; iTF_01043751; iTF_00793492; iTF_01088317; iTF_01127390; iTF_00118661; iTF_00013991; iTF_00334063; iTF_00233877; iTF_00234768; iTF_01224233; iTF_00160669; iTF_00363229; iTF_00176364; iTF_00233876; iTF_00234769; iTF_01518959; iTF_00324341; iTF_00324342; iTF_00628329; iTF_01049642; iTF_00717774; iTF_00324340; iTF_01461140; iTF_01461142; iTF_00202553; iTF_00937273; iTF_00202554; iTF_00203520; iTF_00999557; iTF_00322434; iTF_00424628; iTF_01430823; iTF_00877066; iTF_01431890; iTF_00936521; iTF_01256385; iTF_01183812; iTF_01540311; iTF_00453472; iTF_00454783; iTF_01297371; iTF_00644069; iTF_00643192; iTF_01175074; iTF_00655297; iTF_01237633; iTF_00384546; iTF_00975587; iTF_01397411; iTF_00435525; iTF_01137989; iTF_01374053; iTF_00350150; iTF_01109318; iTF_01376614; iTF_00331496; iTF_00760072; iTF_01114984; iTF_00352491; iTF_00716683; iTF_01176908; iTF_01019405; iTF_01194382; iTF_01236654; iTF_00199855; iTF_00816527; iTF_01374927; iTF_00679472; iTF_00997712; iTF_01259187; iTF_00900564; iTF_01260980; iTF_01162229; iTF_01074454; iTF_01174231; iTF_00371000; iTF_00899544; iTF_01235704; iTF_01313784; iTF_01315480; iTF_00817401; iTF_00899545; iTF_00741850; iTF_01427450; iTF_00892731; iTF_00351838; iTF_01398462; iTF_00922079; iTF_01231551; iTF_01314655; iTF_01127389; iTF_01375811; iTF_01043752; iTF_00793491; iTF_01088316;
- 90% Identity
- iTF_01518961; iTF_00233877; iTF_00234768;
- 80% Identity
- -