Agla003970.1
Basic Information
- Insect
- Anoplophora glabripennis
- Gene Symbol
- -
- Assembly
- GCA_000390285.2
- Location
- NW:1595868-1597510[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 5 0.046 1.3e+02 2.5 0.0 21 37 124 140 115 150 0.70 2 5 1.2 3.5e+03 -2.1 0.0 25 45 158 178 151 186 0.72 3 5 0.00044 1.3 8.9 0.2 22 48 183 209 176 213 0.85 4 5 3.5e-05 0.1 12.4 0.1 21 52 210 241 206 241 0.88 5 5 0.0032 9.2 6.2 0.0 21 48 238 265 236 268 0.89
Sequence Information
- Coding Sequence
- ATGGAATCTAGAGATTCTGATGAATTTCATTCGTCTTTAGAACCAGTTGTAATTATTAATGATGGGGATGTGGATGAAGAAACttttaatagcAAAGATGACGACGATTCAGAAACTGATCCCCTATCAATGGAAAATATTGATAAAGATGATATAATAAATTCGATAGGTCCCGAAATTTCGATTATACCAGTGAAGAGAAAAAGgccacaaataaaaattagactatttgaaaaagaatattCGCCTTCCAAGGATGATAGCAAATTAGTGAAAGTACAAAGTTATAtcagGGCCCCCCGCGAGAAAGTGCGTCGTGTCTCGTTAGACGAAGCCTTAAACGCAGAAGATACCTACGCGAAACGTAAATCTAACCCCCTAGAGAAGTGTCCTATTTGTAAAAAGTACTTCCGTAGAATGAAGACGCACTTACTCAAGCATGAAATGGTAAGTCGGGCTCCGGAGGACCGCCTCTCGTGCACCTATTGCATGAAGGCGTTCAATACCCAAAGCAACCTCGCCATCCACATGCGAACGCACACCGGGGACAAGCCTTATGTGTGCGAGGTCTGCCACAAGTCATTTTCGCAGTCGTGTAACTTGGTAAACCACATGCGGGTGCACACTGGTGAAAAGCCTTTCAAATGTCCACACTGCGACAGAGCCTTCACCCAGTCCGGTAACTTGAACAATCATATCCGTCTGCACACGGACGAGAAGCCTTTCAAATGCCATTTTTGCGACAAAGCGTTTGTACAGTCCGGCAACTTGAGTTCCCACATCAGGAACAACCACAAGTTCGACGATAATACTCTCGAGATTCTGGTTACTCCGCAGTAA
- Protein Sequence
- MESRDSDEFHSSLEPVVIINDGDVDEETFNSKDDDDSETDPLSMENIDKDDIINSIGPEISIIPVKRKRPQIKIRLFEKEYSPSKDDSKLVKVQSYIRAPREKVRRVSLDEALNAEDTYAKRKSNPLEKCPICKKYFRRMKTHLLKHEMVSRAPEDRLSCTYCMKAFNTQSNLAIHMRTHTGDKPYVCEVCHKSFSQSCNLVNHMRVHTGEKPFKCPHCDRAFTQSGNLNNHIRLHTDEKPFKCHFCDKAFVQSGNLSSHIRNNHKFDDNTLEILVTPQ
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00110887;
- 90% Identity
- iTF_00110887;
- 80% Identity
- iTF_00110887;