Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.32 1.4e+03 -0.5 0.0 13 30 5 22 3 36 0.82

2 5 0.00015 0.65 10.1 0.1 21 43 41 63 33 72 0.86

3 5 0.0003 1.3 9.1 0.2 23 47 71 95 67 101 0.83

4 5 0.00093 4.1 7.6 0.1 23 49 99 125 96 129 0.85

5 5 0.0015 6.7 6.9 0.0 23 46 127 150 124 152 0.87

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.32	1.4e+03	-0.5	0.0	13	30	5	22	3	36	0.82
2	5	0.00015	0.65	10.1	0.1	21	43	41	63	33	72	0.86
3	5	0.0003	1.3	9.1	0.2	23	47	71	95	67	101	0.83
4	5	0.00093	4.1	7.6	0.1	23	49	99	125	96	129	0.85
5	5	0.0015	6.7	6.9	0.0	23	46	127	150	124	152	0.87

Coding Sequence: ATGGAGGAAATGGAACAACATCGGACCAAGCATTTGACGGAGAACAAGTTTAAGTGCGAAATATGTAGCAAGGAGTTTCCCAGCCATAGTTCCATGTGGAAGCACACCAAGGCGCATACCGGTGAACGTCCTTTCGTGTGCCAGATATGCAACAAAGGCTTCACCCAGCTGGCCAACCTCCAACGGCATGATCTCGTCCACAACGGACTTAAACCCTTCAAATGTCcaatttgtgaaaaatgttttactcaACAAGCCAACATGCTAAAGCATCAGCTACTTCATACGGGACTGAAGCCGTACAAGTGTCCGGTATGCGAAAAGGCATTTACGCAGCACGCGAACATGATCAAGCATCAAATGCTTCATACCGGTCTCAAACCATATAAATGTCCTGTTTGTGAGAAAGCCTTCACCCAGCAGGCCAACATGGTGAAACATCAAATGTTGCATACCG
Protein Sequence: MEEMEQHRTKHLTENKFKCEICSKEFPSHSSMWKHTKAHTGERPFVCQICNKGFTQLANLQRHDLVHNGLKPFKCPICEKCFTQQANMLKHQLLHTGLKPYKCPVCEKAFTQHANMIKHQMLHTGLKPYKCPVCEKAFTQQANMVKHQMLHT

Sequence clustering based on sequence similarity using MMseqs2