Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 0.0063 28 4.9 0.0 23 48 12 37 9 43 0.84

2 7 0.14 6.3e+02 0.6 0.0 23 49 40 66 37 71 0.82

3 7 0.13 5.8e+02 0.7 0.0 23 48 68 93 65 98 0.81

4 7 0.0083 37 4.5 0.0 23 52 96 125 93 126 0.86

5 7 0.0063 28 4.9 0.0 23 48 124 149 120 153 0.84

6 7 0.0034 15 5.8 0.0 21 46 150 174 147 180 0.87

7 7 2.9e-05 0.13 12.4 0.1 23 44 180 201 177 207 0.91

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	0.0063	28	4.9	0.0	23	48	12	37	9	43	0.84
2	7	0.14	6.3e+02	0.6	0.0	23	49	40	66	37	71	0.82
3	7	0.13	5.8e+02	0.7	0.0	23	48	68	93	65	98	0.81
4	7	0.0083	37	4.5	0.0	23	52	96	125	93	126	0.86
5	7	0.0063	28	4.9	0.0	23	48	124	149	120	153	0.84
6	7	0.0034	15	5.8	0.0	21	46	150	174	147	180	0.87
7	7	2.9e-05	0.13	12.4	0.1	23	44	180	201	177	207	0.91

Coding Sequence: ATGGTCAAACACGAGATGCTGCATACCGGTATCAAACCGTACAAGTGTCCCACCTGTGACAAAGCATTTGCCCAGCAAGCAAACATGATGAAACATCAAATATTGCATAcggGATTGAAGCCGTACAAGTGCGGTACCTGCGACAAAGCGTTTGCCCAGCAGGCCAATATGGTCAAACATCAGATGCTACATACGGGTTTAAAACCGTACAAATGCAATACATGTGACAAGGCATTCGCACAGCAGGCCAACATGGTCAAACACGAGATGCTTCATACCGGAATCAAACCCTACAAATGTTCCATTTGCGATAAAGCCTTTGCCCAGCAGGCCAACATGGTCAAACATCAGATGCTTCACAGCGGAATCAAACCGTACAAATGTCCCACTTGCGATAAAGCCTTTGCCCAGCAGGCGAACATGGTTAAGCATCAGATGCTCCATACGGGAGAAAAACCGTTCAAATGCAAAACCTGTGATAAGGCTTTCACGCAGAATGCTAACCTAAAGAAGCACGAAATGGTACACCTCGGCATTCGGCCGCACACCTGCCCGCTGTGTACGAAGTCCTACTCGCAGTATTCGAACCTCAAGAAGCACTTGCTCAGCCACCAGAAGCAAGCGATcaagcaggagcagcagaaTGGGCAGGTGATGGCCATTCTTTACAGCTGCCAGACATGCAAGATGCAGTTTGAGGACATCATCGAGTTTGAACGCCACACGAGACAGTGCGGCATCAATAGAGTCCAACAGCA
Protein Sequence: MVKHEMLHTGIKPYKCPTCDKAFAQQANMMKHQILHTGLKPYKCGTCDKAFAQQANMVKHQMLHTGLKPYKCNTCDKAFAQQANMVKHEMLHTGIKPYKCSICDKAFAQQANMVKHQMLHSGIKPYKCPTCDKAFAQQANMVKHQMLHTGEKPFKCKTCDKAFTQNANLKKHEMVHLGIRPHTCPLCTKSYSQYSNLKKHLLSHQKQAIKQEQQNGQVMAILYSCQTCKMQFEDIIEFERHTRQCGINRVQQ

Sequence clustering based on sequence similarity using MMseqs2