Basic Information

Transcription Factor Domain

TF Family: BTB
Domain: zf-C2H2|ZBTB
PFAM: PF00651
TF Group: Zinc-Coordinating Group
Description: The BTB (for BR-C, ttk and bab) [6] or POZ (for Pox virus and Zinc finger) [1] domain is present near the N-terminus of a fraction of zinc finger (Pfam:PF00096) proteins and in proteins that contain the Pfam:PF01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerisation and in some instances heteromeric dimerisation [1]. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule [2]. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT [5, 3, 4]. The POZ or BTB domain is also known as BR-C/Ttk or ZiN.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 1.7 5.1e+02 0.9 0.1 85 104 19 38 14 43 0.83

2 3 1.3e-20 4e-18 65.6 0.0 6 104 111 211 108 217 0.89

3 3 0.22 67 3.7 0.1 80 109 219 248 208 249 0.86

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	1.7	5.1e+02	0.9	0.1	85	104	19	38	14	43	0.83
2	3	1.3e-20	4e-18	65.6	0.0	6	104	111	211	108	217	0.89
3	3	0.22	67	3.7	0.1	80	109	219	248	208	249	0.86

Coding Sequence: ATTACCATCGAGCTGCGGGCCCTGGGCGTACCGTGGACGCTGCACTGCTGGATGCACGCGCTGGCCGCCGCCCACGAGCTCCGCCTCGATGCCGtcatcgatcagctgctgcaggacTTTCTGCAGGTGTGCCCGGACGACTACAGCCAGCAGTTTGTGACGGAGTGTTTGCCGCTGCTGTTCAACATATTCCGCTACAGCAAGAAGGAAGGcacgacgctgctgctggccgatATCTTCAGCACCTGCTTCGGCTGGGAACCGATCAAACCGATCAAGGAGCCCGTCCTGCAGCCCTCGAACGGATCGCGCATCGATCCGAAGTTCGTCAACAATCCCGAGCTGAGCGATGTCACATTCCGGGTGGAAAATCGCATCTTTTACGGGCACAAAATCGTTCTCGTCACCGCATCTCCGCGTCTGCAGAGTATGTTGAGCTCGAAGCTGAACGAAGGCACCGGCACACCGACCGTGCAGATTAACGACATCCGCTACCATATATTCGAGTTGGTGATGCAGTTCCTGTACAGTGGAGGCTGCAGCGCCCTGGACGTGGTGGCCGGCGACGTGCTAGAGCTGATGGCGGCGGCCAGCTTCTTCCAGCTGGAGGGTCTGCTGCGCTACACGGAGGCACGCTGCGCGGAGATGATCGACATCGACAACGTGGTCGCCATGTACATACACGCCAAGGTCTACAACGCCCAGAAGCTGATGGAGTACTGCCAGGGTTTTCTGCTGCAGAACATGGTCGCACTGCTGACGTACGACGATTCGGTGAAGCGGTTACTGTTTGCGAAGAAAATCCCCAACCATGACGTGCTGACCGGGCTGCTGACCACGCTGCAGGCCCGCATCAAGGCCCGCCGCAGCAGTGCGGCCACATCGAACGGAACCGGTGGTGCTTCAGCGAACGGCGGTCCCACCACACCCAACCCGGCACCGGCAAGCCGCCCGATGGCACCCAGCGGAAAGTCTTCTAAGTAA
Protein Sequence: ITIELRALGVPWTLHCWMHALAAAHELRLDAVIDQLLQDFLQVCPDDYSQQFVTECLPLLFNIFRYSKKEGTTLLLADIFSTCFGWEPIKPIKEPVLQPSNGSRIDPKFVNNPELSDVTFRVENRIFYGHKIVLVTASPRLQSMLSSKLNEGTGTPTVQINDIRYHIFELVMQFLYSGGCSALDVVAGDVLELMAAASFFQLEGLLRYTEARCAEMIDIDNVVAMYIHAKVYNAQKLMEYCQGFLLQNMVALLTYDDSVKRLLFAKKIPNHDVLTGLLTTLQARIKARRSSAATSNGTGGASANGGPTTPNPAPASRPMAPSGKSSK

Sequence clustering based on sequence similarity using MMseqs2