Agam001480.1
Basic Information
- Insect
- Anopheles gambiae
- Gene Symbol
- odd
- Assembly
- GCF_000005575.2
- Location
- NT:7095801-7116750[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 4 0.00033 0.83 9.3 0.2 21 46 29 54 23 60 0.83 2 4 0.016 40 3.9 0.1 21 44 57 80 51 85 0.86 3 4 2.2e-05 0.056 13.1 0.3 22 45 86 109 83 116 0.86 4 4 0.00091 2.3 7.9 0.5 23 43 115 135 110 139 0.89
Sequence Information
- Coding Sequence
- CCCAAGAAACAGTTCATCTGCAAGTTCTGCAACCGCCAGTTCACCAAATCGTACAACCTGCTCATCCACGAGCGGACGCACACGGACGAGCGGCCGTACTCGTGTGACATCTGTCTGAAGGCGTTCCGAAGGCAGGATCATCTACGCGATCACAGATACATCCACTCCAAGGAAAAGCCATTCAAATGCACCGAATGTGGCAAAGGCTTCTGCCAGTCGCGCACCCTCGCCGTCCACAAGATCCTGCACATGGAGGAATCGCCGCACAAGTGTCCCGTGTGCAACCGGAGCTTCAACCAGCGCTCCAACCTGAAGACGCACCTGCTCACCCACACCGACCACAAGCCGTACGAGTGCAACTCGTGCGGGAAAGTCTTCCGCCGGAACTGCGACCTGCGGCGCCATGCCCTAACGCAC
- Protein Sequence
- PKKQFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICLKAFRRQDHLRDHRYIHSKEKPFKCTECGKGFCQSRTLAVHKILHMEESPHKCPVCNRSFNQRSNLKTHLLTHTDHKPYECNSCGKVFRRNCDLRRHALTH
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00102547;
- 90% Identity
- iTF_00102547;
- 80% Identity
- iTF_00102547;