Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 0.0014 15 4.6 0.7 8 15 9 16 6 17 0.92

2 3 1.6e-09 1.7e-05 23.6 7.6 3 22 59 78 57 78 0.85

3 3 1 1e+04 -6.3 7.0 12 18 91 97 90 100 0.58

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	0.0014	15	4.6	0.7	8	15	9	16	6	17	0.92
2	3	1.6e-09	1.7e-05	23.6	7.6	3	22	59	78	57	78	0.85
3	3	1	1e+04	-6.3	7.0	12	18	91	97	90	100	0.58

Coding Sequence: ATGTCGGACGTGGAAACCCAAGAACCCAAGAAGGGACGCGGACGTCCTGCGGCCGTGGAGAGAAATAGCGTGGCTCCGAAAAAGCGTGCCCGGGCCCTCTCGCCGAAGGATACGAAGCTGGTGGAGGAAAAGGAGCACGAAAAGGCAGTGCTGTCGGACGAAGGGGATGACAGCGGAGAGGAGCCCTCTCCGAAGCGTGGCCGGGGTCGACCGAAGGGCGTCGTGAAGAAGGGAGCTAAGGCCGCCAAAAAGGCACCGGCTGCTACCGGTCGGGGACGAGGCCGGGGTAAGAAGAAGCCGACCAAGGAATCTTCtgacgaggaggacgaggacgatgatgatgacgaggaggaggaggaggacgatctggaggatAGCGAAGAGAACGAGGAGAACTTTGACAACGATGAGTCCGATTAA
Protein Sequence: MSDVETQEPKKGRGRPAAVERNSVAPKKRARALSPKDTKLVEEKEHEKAVLSDEGDDSGEEPSPKRGRGRPKGVVKKGAKAAKKAPAATGRGRGRGKKKPTKESSDEEDEDDDDDEEEEEDDLEDSEENEENFDNDESD

Sequence clustering based on sequence similarity using MMseqs2