Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.033 67 3.4 0.0 22 49 17 44 4 47 0.83

2 6 0.00014 0.29 11.0 0.0 21 52 44 75 41 76 0.89

3 6 0.056 1.2e+02 2.7 0.0 21 47 72 98 70 103 0.83

4 6 0.00075 1.5 8.7 0.1 21 46 100 125 95 132 0.90

5 6 0.00066 1.4 8.8 0.0 21 51 132 162 126 163 0.88

6 6 0.00066 1.4 8.8 0.1 21 46 160 185 158 195 0.87

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.033	67	3.4	0.0	22	49	17	44	4	47	0.83
2	6	0.00014	0.29	11.0	0.0	21	52	44	75	41	76	0.89
3	6	0.056	1.2e+02	2.7	0.0	21	47	72	98	70	103	0.83
4	6	0.00075	1.5	8.7	0.1	21	46	100	125	95	132	0.90
5	6	0.00066	1.4	8.8	0.0	21	51	132	162	126	163	0.88
6	6	0.00066	1.4	8.8	0.1	21	46	160	185	158	195	0.87

Coding Sequence: ATGTCACAGGCAGTGGAGAGCGCCGGCAGCGAGAAGATTCCCAACTGCTCGAAACCGTTCGAGTGCTCTGAATGCAACAAACTGTTCCGCCAGCTCAGTACGCTGACCAACCACATGAAGATCCACACCGGCGAGAAGCCTTACAAGTGCACTATTTGTGCGAAGGAGTTCCGCCAAACGACCACGCTGTCCAATCACCTGAAGATTCACACCGGTGAAAAGCCGTTCAATTGCAACTTCTGTGGCAAACAGTTCCGGCAGCTGAGCACCTTGTCGAACCACCAGAAGATCCACACCGGCGAGAAGCCGTTCGAGTGCTCGGTGTGCGGCAAACAGTTCCGCCAGTCCAGCACGCTCAACAGTCATATCAGGATCCACTCGGATGATAAGTTTTGTGAAAAGCCGTACGCCTGCACGTACTGCGGCAAAATGTTCCGCCAGACGGGAACGCTTTCCAATCATCTGAAAattcacaccggcgaaaaaccGTTCGAATGCTCGGTGTGCGGCAAACAGTTCCGCCAGTCCAGTACCTTGAACAGCCACATACGTATCCATGCGGACGATAAATATTGTAAACCTTCGAGCCCCCCAACCATTAGCACAACGGTCACCGGTGGACTCAACATAAAGGTTGAGGACATCAAACCATTTTACGCGCTGATCTAA
Protein Sequence: MSQAVESAGSEKIPNCSKPFECSECNKLFRQLSTLTNHMKIHTGEKPYKCTICAKEFRQTTTLSNHLKIHTGEKPFNCNFCGKQFRQLSTLSNHQKIHTGEKPFECSVCGKQFRQSSTLNSHIRIHSDDKFCEKPYACTYCGKMFRQTGTLSNHLKIHTGEKPFECSVCGKQFRQSSTLNSHIRIHADDKYCKPSSPPTISTTVTGGLNIKVEDIKPFYALI

Sequence clustering based on sequence similarity using MMseqs2