Amar060792.1
Basic Information
- Insect
- Anisolabis maritima
- Gene Symbol
- -
- Assembly
- GCA_010014785.1
- Location
- JAAAKE010008224.1:44739884-44740360[-]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 5 0.0048 1.1e+02 4.9 0.0 25 44 10 29 4 32 0.87 2 5 0.00016 3.7 9.6 0.1 21 51 34 64 30 65 0.85 3 5 0.0015 34 6.5 0.2 21 44 62 85 58 89 0.83 4 5 0.0013 30 6.7 0.0 22 45 91 114 86 117 0.85 5 5 0.011 2.6e+02 3.7 0.0 21 46 118 143 114 146 0.87
Sequence Information
- Coding Sequence
- atgCGAATTCATGCCGGTGAAAAATTATATGGGTGTCCTGAATGCCCAGCGCGATTTTATAAAAGTGGCGATCTGAATCGACATATACGCACTCATTCAGGTGAAAAGCCCTATTCATGTCTCATCTGTGACACGAAATTCACTCAGAACAATCATCTGAAAAGTCATCTACGTATACATTCAGGTGAGAAGCCATTCACATGCCCGCATTGTCCTCAAAGTTTTAATCGAAAGGATAGCCTAAAAAGTCATTTAATCAATCACACTGGCGATAAACCTCACGCCTGCACTATATGCGTGGCGAGCTTTATAAAACGGGGTGATTTGACCAAACATCTACGCAAACATTCAGGCGAAAAACCATTCGAATGTAAGGATTGCAATAAATCATTTAGTAATAAGTCAAATCTAACTAGACATTATAAAATGCATGAGAATCCATCGCAAATGGATGAAAATTCAGAACATAATacgtaa
- Protein Sequence
- MRIHAGEKLYGCPECPARFYKSGDLNRHIRTHSGEKPYSCLICDTKFTQNNHLKSHLRIHSGEKPFTCPHCPQSFNRKDSLKSHLINHTGDKPHACTICVASFIKRGDLTKHLRKHSGEKPFECKDCNKSFSNKSNLTRHYKMHENPSQMDENSEHNT
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00090652;
- 90% Identity
- iTF_00090652;
- 80% Identity
- iTF_00090652;