Basic Information

Transcription Factor Domain

TF Family: BTB
Domain: zf-C2H2|ZBTB
PFAM: PF00651
TF Group: Zinc-Coordinating Group
Description: The BTB (for BR-C, ttk and bab) [6] or POZ (for Pox virus and Zinc finger) [1] domain is present near the N-terminus of a fraction of zinc finger (Pfam:PF00096) proteins and in proteins that contain the Pfam:PF01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerisation and in some instances heteromeric dimerisation [1]. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule [2]. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT [5, 3, 4]. The POZ or BTB domain is also known as BR-C/Ttk or ZiN.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 0.011 3.3 10.5 0.1 56 90 1 35 1 38 0.90

2 3 6.9e-12 2.1e-09 40.1 0.4 34 95 39 99 36 109 0.90

3 3 1.8e-26 5.4e-24 87.1 1.3 5 109 107 210 103 211 0.93

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	0.011	3.3	10.5	0.1	56	90	1	35	1	38	0.90
2	3	6.9e-12	2.1e-09	40.1	0.4	34	95	39	99	36	109	0.90
3	3	1.8e-26	5.4e-24	87.1	1.3	5	109	107	210	103	211	0.93

Coding Sequence: atgAGTGATATCAAGGCTCAAGTGGTTATGGAAATGCTTAGATTCATATACCTTGCCAGAGTGGAGAATCTTCATGAAGTTGCTGATGATCTGTTGCCATTATCAGATATCAAAAGCCTGGTGTTTGAGGCCATGTTCAAACATGAGATGAAAGAGaacaaagaaaatgttataaacattGGTGATATCAATCCCGAAGTGTTTATGGAAATGCTTAGATTCATATACGTTGCCAAAGTAGAGAATCTTCATGAAATTGCTGAAGATCTGTTGCTATTAGCAGACATactCGATGAAATAGAgcatttcgaaaaaatattggataGTGGATGTTTTGTTAGTGATGTGATTATAAACGCTcgtggaaaaaaatttcatgcccATAAAATTATGTTGTGCAATAAAAGTCCGGTGTTCGAGGCCATGTTTAAACATGAGatgaaagagaagaaagaaaatgttataaacatgAGTGATATCAAGGCTCAAGTGGTTATGGAAATGCTTAGATTCATATACCTTGCCAAAGTGGAGAATCTTCATGAAGTTGCTGATGATCTGTTGCCATTAGCAGATATGTACGTTTTGGATGGATTAAAGAacatatgtgaaaaatacattattgaaaaattgGCCATCAATAATgcatttcattatattaagtTAGCTTCTCTGTATAATGCTACTAATTTGAAAAAAGGAGTTATTGAATTTATCAAATCAAATAGattagaattaaaaaagttGGGTGAAAATGAATTAGAggaatcttttaaaaacatgGATACAAAAGTTTTGTGTGAAATTGTGTACGCATTGGCGTCAACGTAA
Protein Sequence: MSDIKAQVVMEMLRFIYLARVENLHEVADDLLPLSDIKSLVFEAMFKHEMKENKENVINIGDINPEVFMEMLRFIYVAKVENLHEIAEDLLLLADILDEIEHFEKILDSGCFVSDVIINARGKKFHAHKIMLCNKSPVFEAMFKHEMKEKKENVINMSDIKAQVVMEMLRFIYLAKVENLHEVADDLLPLADMYVLDGLKNICEKYIIEKLAINNAFHYIKLASLYNATNLKKGVIEFIKSNRLELKKLGENELEESFKNMDTKVLCEIVYALAST*

Sequence clustering based on sequence similarity using MMseqs2