Basic Information

Transcription Factor Domain

TF Family: Fork_head
Domain: Fork_head domain
PFAM: PF00250
TF Group: Helix-turn-helix
Description: The fork head domain is a conserved DNA-binding domain (also known as a winged helix) of about 100 amino-acid residues. Drosophila melanogaster fork head protein is a transcription factor that promotes terminal rather than segmental development, contains neither homeodomains nor zinc-fingers characteristic of other transcription factors [1]. Instead, it contains a distinct type of DNA-binding region, containing around 100 amino acids, which has since been identified in a number of transcription factors (including D. melanogaster FD1-5, mammalian HNF-3, human HTLF, Saccharomyces cerevisiae HCM1, etc.). This is referred to as the fork head domain but is also known as a 'winged helix' [1, 2, 3]. The fork head domain binds B-DNA as a monomer [2], but shows no similarity to previously identified DNA-binding motifs. Although the domain is found in several different transcription factors, a common function is their involvement in early developmental decisions of cell fates during embryogenesis [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 1.3 1.7e+03 0.1 0.1 49 69 20 40 3 49 0.70

2 3 0.17 2.2e+02 3.0 0.0 20 42 50 72 45 79 0.82

3 3 8.8e-11 1.2e-07 32.7 0.0 2 41 83 122 82 124 0.95

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	1.3	1.7e+03	0.1	0.1	49	69	20	40	3	49	0.70
2	3	0.17	2.2e+02	3.0	0.0	20	42	50	72	45	79	0.82
3	3	8.8e-11	1.2e-07	32.7	0.0	2	41	83	122	82	124	0.95

Coding Sequence: ATGGCTGAAATCACCACATCTAACGCAACTATGTCAAATCAAGTATTTCAATCGAATTATTCAATTCGATCTCTTCTCTCTGGCTGTGAATCCATGGACACAGTCTCTAAAAATCAGACAGCCAACAATACTAAGAAGCTTATATCAAAGACACAATTGCCGATATCACAAATTTGTTCATATGTGGAGCTTCACACTTTATCATTCGATGAAAGCATGTCATCAGAAAGCAAATCACCTCATGGCAAGCATACATATAGCTTCAGTGACCTAATCATAATGGGCATAGGGATCAGTGAAGAAAAACATCTAACTCTTAGTACTATTTATGATTGGATTGCCGAGAAATTTCACTGCTATCAGAATTGTAACTAA
Protein Sequence: MAEITTSNATMSNQVFQSNYSIRSLLSGCESMDTVSKNQTANNTKKLISKTQLPISQICSYVELHTLSFDESMSSESKSPHGKHTYSFSDLIIMGIGISEEKHLTLSTIYDWIAEKFHCYQNCN

Sequence clustering based on sequence similarity using MMseqs2