Avir001783.1
Basic Information
- Insect
- Altica viridicyanea
- Gene Symbol
- -
- Assembly
- None
- Location
- GWHAMMQ00000122:971995-972862[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 5 2.3 1.8e+02 2.3 0.2 26 46 11 31 4 37 0.84 2 5 0.0043 0.34 11.0 0.2 21 44 62 85 59 89 0.91 3 5 0.11 8.9 6.5 0.1 21 52 90 121 86 122 0.86 4 5 2.9 2.3e+02 2.0 0.2 21 34 118 131 115 145 0.70 5 5 0.0033 0.26 11.4 0.0 21 46 146 171 138 175 0.90
Sequence Information
- Coding Sequence
- ATGAGGACTTACAGAAGACAAAAATCCTTTAAATGTAAAATTTGTTTTAAATGTTTTACACGAAAAAAAGATTTAATACAGCATATTAGAATTCACACTGACGGGAAATCTTTTAAATGTAAAATTTGTTCAAAGTGTTTTACAGAATTCGAACATTTAAAAATGCATATTGAAACTCACACTGACGAGAAACCTTTTAAATGTAAAATTTGTTCAAAGTGTTTTACACAATCCAGATATTTAAAAATTCATATTAGAACTCACACTGGTGAAAAACCTTTCAAATGTAACATTTGTTTGAAGCGTTTTACAGATCGAAGTATCCTAAAACGGCATATTCAAATCCACACTGGTGAGAAACCTTTCAGTTGTAAAATTTGTTCAAAATGTTTTATAGGACAAACTAGCTTAAAACTGCATATTAGAACTCACACTGGAGAGAAACCTTTTAAATGTAAAACTTGTTCAAAATGCTTCACACAATCCGGTAATTTAACAATGCACATAGAACTCACACTGATGAAAAACCTTTTAAATGTAAGATTTGTTCAAAGTGTTTCACACAATCCAGATATTTAA
- Protein Sequence
- MRTYRRQKSFKCKICFKCFTRKKDLIQHIRIHTDGKSFKCKICSKCFTEFEHLKMHIETHTDEKPFKCKICSKCFTQSRYLKIHIRTHTGEKPFKCNICLKRFTDRSILKRHIQIHTGEKPFSCKICSKCFIGQTSLKLHIRTHTGEKPFKCKTCSKCFTQSGNLTMHIELTLMKNLLNVRFVQSVSHNPDI
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00057112;
- 90% Identity
- iTF_00057112;
- 80% Identity
- iTF_00057112;