Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 2.3 1.8e+02 2.3 0.2 26 46 11 31 4 37 0.84

2 5 0.0043 0.34 11.0 0.2 21 44 62 85 59 89 0.91

3 5 0.11 8.9 6.5 0.1 21 52 90 121 86 122 0.86

4 5 2.9 2.3e+02 2.0 0.2 21 34 118 131 115 145 0.70

5 5 0.0033 0.26 11.4 0.0 21 46 146 171 138 175 0.90

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	2.3	1.8e+02	2.3	0.2	26	46	11	31	4	37	0.84
2	5	0.0043	0.34	11.0	0.2	21	44	62	85	59	89	0.91
3	5	0.11	8.9	6.5	0.1	21	52	90	121	86	122	0.86
4	5	2.9	2.3e+02	2.0	0.2	21	34	118	131	115	145	0.70
5	5	0.0033	0.26	11.4	0.0	21	46	146	171	138	175	0.90

Coding Sequence: ATGAGGACTTACAGAAGACAAAAATCCTTTAAATGTAAAATTTGTTTTAAATGTTTTACACGAAAAAAAGATTTAATACAGCATATTAGAATTCACACTGACGGGAAATCTTTTAAATGTAAAATTTGTTCAAAGTGTTTTACAGAATTCGAACATTTAAAAATGCATATTGAAACTCACACTGACGAGAAACCTTTTAAATGTAAAATTTGTTCAAAGTGTTTTACACAATCCAGATATTTAAAAATTCATATTAGAACTCACACTGGTGAAAAACCTTTCAAATGTAACATTTGTTTGAAGCGTTTTACAGATCGAAGTATCCTAAAACGGCATATTCAAATCCACACTGGTGAGAAACCTTTCAGTTGTAAAATTTGTTCAAAATGTTTTATAGGACAAACTAGCTTAAAACTGCATATTAGAACTCACACTGGAGAGAAACCTTTTAAATGTAAAACTTGTTCAAAATGCTTCACACAATCCGGTAATTTAACAATGCACATAGAACTCACACTGATGAAAAACCTTTTAAATGTAAGATTTGTTCAAAGTGTTTCACACAATCCAGATATTTAA
Protein Sequence: MRTYRRQKSFKCKICFKCFTRKKDLIQHIRIHTDGKSFKCKICSKCFTEFEHLKMHIETHTDEKPFKCKICSKCFTQSRYLKIHIRTHTGEKPFKCNICLKRFTDRSILKRHIQIHTGEKPFSCKICSKCFIGQTSLKLHIRTHTGEKPFKCKTCSKCFTQSGNLTMHIELTLMKNLLNVRFVQSVSHNPDI

Sequence clustering based on sequence similarity using MMseqs2