Avir001511.1
Basic Information
- Insect
- Altica viridicyanea
- Gene Symbol
- -
- Assembly
- None
- Location
- GWHAMMQ00001175:172896-177262[-]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 5 1.1 83 3.4 0.3 22 48 18 44 12 49 0.88 2 5 0.26 20 5.4 0.2 21 44 74 97 64 101 0.80 3 5 0.0083 0.65 10.1 0.1 21 48 102 129 98 133 0.87 4 5 0.0032 0.25 11.5 0.1 21 46 130 155 126 157 0.91 5 5 0.0046 0.37 10.9 0.1 21 46 158 183 155 188 0.91
Sequence Information
- Coding Sequence
- ATGTTTCACAAAATCCAAGTGTTTAAAATGCATGTTAGAATTCACACTGGCGATAAACCTTTTAGATGTGAATATTGTTCAAAGTGTTTCACAGAAAATAGAAGATTAAAAAATCATCTTACTAGAGATCACACTGGTGAAAAGTCATTCAAATGTGAAATTTGTTTAAAATGTTTCACACTACAAATTGATTTAAAACAACATATTAGAACTCACAGTAACGAGAAACCTTTTAAATGTAAAATTTGTTCAAAATGTTTCACAGGACAAAGTCATTTAAATCGACATGTTAAAACTCATACCGGTGAAAAACCTTTTAAATGTGAAATTTGTTCAAAATGTTTCACAACATCTAGCCATTTAAAAAGGCATATTAGAATTCACACTGGTGAGAAACCTTTTATATGTAAAATTTGTTCAAAATGTTACGTACAATCTGGTAATTTAAATAAGCATATTAAAATTCACACTGATGAAAAACCTTTTAAATGTAAAATTTGTTTGAAATGTTTCATACAATCCAGTGATTTAAAAAAGCATATTAGAATTCACACAGGTGAAAAATCTTACAAATGTGAAATTTGTTCAAAATCTTTCTCAGAAAAAAACAACCTTAAAGTCACACATTATTAG
- Protein Sequence
- MFHKIQVFKMHVRIHTGDKPFRCEYCSKCFTENRRLKNHLTRDHTGEKSFKCEICLKCFTLQIDLKQHIRTHSNEKPFKCKICSKCFTGQSHLNRHVKTHTGEKPFKCEICSKCFTTSSHLKRHIRIHTGEKPFICKICSKCYVQSGNLNKHIKIHTDEKPFKCKICLKCFIQSSDLKKHIRIHTGEKSYKCEICSKSFSEKNNLKVTHY
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00057073;
- 90% Identity
- iTF_00057073;
- 80% Identity
- iTF_00057073;