Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 2.5 2e+02 2.2 1.6 15 31 16 33 12 63 0.66

2 7 7.4 5.8e+02 0.7 0.1 24 50 62 88 55 90 0.79

3 7 0.055 4.3 7.5 0.1 21 47 87 113 79 118 0.84

4 7 0.081 6.4 7.0 0.0 21 44 115 138 112 143 0.90

5 7 0.067 5.3 7.2 0.0 21 47 143 169 140 176 0.85

6 7 0.27 21 5.3 0.1 22 47 172 197 169 202 0.85

7 7 0.0057 0.45 10.7 0.0 21 44 199 222 196 228 0.90

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	2.5	2e+02	2.2	1.6	15	31	16	33	12	63	0.66
2	7	7.4	5.8e+02	0.7	0.1	24	50	62	88	55	90	0.79
3	7	0.055	4.3	7.5	0.1	21	47	87	113	79	118	0.84
4	7	0.081	6.4	7.0	0.0	21	44	115	138	112	143	0.90
5	7	0.067	5.3	7.2	0.0	21	47	143	169	140	176	0.85
6	7	0.27	21	5.3	0.1	22	47	172	197	169	202	0.85
7	7	0.0057	0.45	10.7	0.0	21	44	199	222	196	228	0.90

Coding Sequence: ATGTTGAAATGTAAAATTTGTTTAGAAATGTTTAAAGTGAATTATCCATTTCGAAGAGCTCAGTCTAAAGTAAAACCCGTTTGTTGCAAAATTTGTGAAAAAAATAATTTTAAATGTTTAAAGGTGTGTATACAAAAAGTCACTGATTTAAAAGAACATTTGAAAATACACAATGCAAAAAAAGCAAATAAATGTGAAATCTGTTCAAAATTTTTTAATTATAAATGTGATTTAAAGCAACATATGAGAATGCATACTAAAGAAAAGCCATTTAAATGTGAAATTTGTTCATACACGTGTGGACAAAAATCAAATTTAAACACACATATGCTAATACACAGTAAAGAAAAGCCATTTAAATGTGAAATTTGTTCACATACCTTTGGACAAAAATCAAATTTAAACACACATATGGTAGTACACTCTAAAGAAAAACCATTTAAATGTGAAATTTGTTCACATAGCTTTGGACAAAAATCAAATTTAAACACACATATACTAATACACACTGAAGAAAAGCCATTTAAATGTAAAATGTGTTCACATTCATTTCGACATAAATTAAGTTTAAATAGACATATGCTAGTACACTCTAAAGAAAAGCCATTTAAATGTGAAATTTGTTCACATACCTTTCGAGAAAAATCAAATTTAAAAAAACATATTCTAATACATACTGGTGAAAAGTTTTAA
Protein Sequence: MLKCKICLEMFKVNYPFRRAQSKVKPVCCKICEKNNFKCLKVCIQKVTDLKEHLKIHNAKKANKCEICSKFFNYKCDLKQHMRMHTKEKPFKCEICSYTCGQKSNLNTHMLIHSKEKPFKCEICSHTFGQKSNLNTHMVVHSKEKPFKCEICSHSFGQKSNLNTHILIHTEEKPFKCKMCSHSFRHKLSLNRHMLVHSKEKPFKCEICSHTFREKSNLKKHILIHTGEKF

Sequence clustering based on sequence similarity using MMseqs2