Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 0.0077 0.61 10.2 0.2 26 46 12 32 7 38 0.85

2 7 0.32 25 5.0 0.0 21 44 35 58 31 65 0.90

3 7 1.6 1.3e+02 2.8 0.0 25 51 67 93 58 95 0.78

4 7 0.12 9.6 6.4 0.1 21 44 91 114 80 118 0.88

5 7 0.006 0.48 10.6 0.2 21 45 119 143 114 147 0.90

6 7 0.0085 0.68 10.1 0.0 21 48 147 174 143 178 0.87

7 7 4.2 3.3e+02 1.5 0.2 21 44 175 198 171 204 0.85

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	0.0077	0.61	10.2	0.2	26	46	12	32	7	38	0.85
2	7	0.32	25	5.0	0.0	21	44	35	58	31	65	0.90
3	7	1.6	1.3e+02	2.8	0.0	25	51	67	93	58	95	0.78
4	7	0.12	9.6	6.4	0.1	21	44	91	114	80	118	0.88
5	7	0.006	0.48	10.6	0.2	21	45	119	143	114	147	0.90
6	7	0.0085	0.68	10.1	0.0	21	48	147	174	143	178	0.87
7	7	4.2	3.3e+02	1.5	0.2	21	44	175	198	171	204	0.85

Coding Sequence: ATGTTAAAACCCACAATGGCGAAAAACGTTTTTAAATGTAAGATATGTTCAAAATGTTTCACACAATCCTATAATTTAAATAGGCATATTAAAACTCACACTGGCGAAAAACCTTTTAAATGTAAATTATGTTCGAAATGTTTCACACAATTGGGTAATTTAAAAAGTCATGTTAGAACTCATACTGACCAGAAATCTTTTAAATGTGAAATATGTTCGAAAGGTTTCAAATATTCCAGTACCTTAAAAAATCATATTAGAATTCACACTGGCGAGAAACCTTTTAAATGTAAATTATGTTTGAAATGTTTCAGACACTCCGGTAGTTTAAAAGTTCATATTAGAACTCACACTAACGAAAAACCTTTTAAATGTAAATTATGTTCAAAATGTTTCACACAATCCAGTCATTTAAAACGTCATATTAAAACTCACACTGCTGAAAAACCTTTTAAATGTAAGATTTGTTCGAAATGTTTCACAGACTCTAGTAATTTAAAAATTCATATTAGAATTCACACTGGCGAGAAACCTTTTAAATGTAAATTATGTTCGAAATGTTTCACACACTCCGGTTGTTTAAAAGTTCATATTATTAGAACTCACACTGAAGAAAACCTTTTAAATGTAAAATTATGTTCGAAAATGTTTCACTAA
Protein Sequence: MLKPTMAKNVFKCKICSKCFTQSYNLNRHIKTHTGEKPFKCKLCSKCFTQLGNLKSHVRTHTDQKSFKCEICSKGFKYSSTLKNHIRIHTGEKPFKCKLCLKCFRHSGSLKVHIRTHTNEKPFKCKLCSKCFTQSSHLKRHIKTHTAEKPFKCKICSKCFTDSSNLKIHIRIHTGEKPFKCKLCSKCFTHSGCLKVHIIRTHTEENLLNVKLCSKMFH

Sequence clustering based on sequence similarity using MMseqs2