Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.00016 0.013 15.6 0.4 21 44 17 40 9 44 0.89

2 6 0.0045 0.35 11.0 0.0 21 52 45 76 40 76 0.87

3 6 0.0052 0.41 10.8 0.1 21 52 73 104 69 105 0.88

4 6 3 2.4e+02 1.9 0.1 21 44 101 124 98 129 0.87

5 6 0.0086 0.68 10.1 0.1 21 44 129 152 125 156 0.90

6 6 0.14 11 6.2 0.1 21 45 157 181 152 183 0.89

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.00016	0.013	15.6	0.4	21	44	17	40	9	44	0.89
2	6	0.0045	0.35	11.0	0.0	21	52	45	76	40	76	0.87
3	6	0.0052	0.41	10.8	0.1	21	52	73	104	69	105	0.88
4	6	3	2.4e+02	1.9	0.1	21	44	101	124	98	129	0.87
5	6	0.0086	0.68	10.1	0.1	21	44	129	152	125	156	0.90
6	6	0.14	11	6.2	0.1	21	45	157	181	152	183	0.89

Coding Sequence: ATGTTTCCCAACATCCGGTTACTTAAAACTCATAATAGAACTCACATTGGTGAGAAACCTTTTAAATGTAAAATTTGTTCAAAATGTTTCACACAATCCTGTAATTTAAAAAGACATATTAGAACTCATACTGACGAGAAACCTTTTAAATGTAAAATTTGTTCGAAATGTTTCACAGATTCCAGTGGATTAAAAAGGCATATTAGAATTCACACTAACGAGAAACCTTTTAAATGTAAAATATGTTCGAAATATTTCACACAATGCGGTAATTTAAAATCTCATATTCAAATTCACACTGACGAGAAACCTTTTAAATGTAAATTATGTTCGAAATGTTTCACACGATCCGATTATTTAAATAACCATATTAGAACTCACACTAAAGAAAAACCTTTTAAATGTAAATTATGTTCGAAATGTTTCACTCAATCCAGTAACTTAAAAACACATGTTAGAACTCACACTGGTGAGAAACCTTTTAAATGTAAAATTTGTTCGCAATGTTTTACAAGATCCAGTCATTTAAAAACTCATATTAAAACACACTGA
Protein Sequence: MFPNIRLLKTHNRTHIGEKPFKCKICSKCFTQSCNLKRHIRTHTDEKPFKCKICSKCFTDSSGLKRHIRIHTNEKPFKCKICSKYFTQCGNLKSHIQIHTDEKPFKCKLCSKCFTRSDYLNNHIRTHTKEKPFKCKLCSKCFTQSSNLKTHVRTHTGEKPFKCKICSQCFTRSSHLKTHIKTH

Sequence clustering based on sequence similarity using MMseqs2