Avir005333.1
Basic Information
- Insect
- Altica viridicyanea
- Gene Symbol
- -
- Assembly
- None
- Location
- GWHAMMQ00001945:40559-41419[-]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 6 0.034 2.7 8.2 0.0 21 47 6 32 4 37 0.86 2 6 0.0064 0.5 10.5 0.1 21 48 34 61 30 66 0.90 3 6 1.5 1.2e+02 2.9 0.2 21 44 63 86 61 90 0.77 4 6 0.056 4.5 7.5 0.0 21 44 91 114 88 118 0.90 5 6 0.052 4.1 7.6 0.0 21 47 119 145 116 150 0.85 6 6 0.0034 0.27 11.4 0.0 21 44 147 170 144 174 0.89
Sequence Information
- Coding Sequence
- ATGCTAATACATACTAAAGAAAAGCCATTTAAATGTGAAATTTGTTCACATACCTTTGGACAAAAATCAAATTTAAACACACATATGGTAGTACACTCTAAAGAAAAGCCATTTAAATGTGAAATTTGTTCATACACGTGTGGACAAAAATCAAGTTTAAATAGACATATTATGCTAGTACACTCTAAAGAAAAGCCATTTAAATGTGAAATTTGTTCATACACGTGTGGACTAAAATCAAGTTTAAATAGACATATGCTAGTACACTCTAAAGAAAAGCCATTTAAATGTGAAATTTGTTCACATACCTTTGGACAAAAATCAAATTTAAACACACATATGGTAGTACACTCTAAAGAAACGCCATTTAAATGTGAAATTTGTTCACATACCTTTGGACAAAAATCAAATTTAAACACACATATGGTAGTACACTCTAAAGAAAAGCCATTTAAATGTGAAATTTGTTCACATACCTTTGGACAAAAATCAAATTTAAACAGACATATGCTAAAACACACTAAATAA
- Protein Sequence
- MLIHTKEKPFKCEICSHTFGQKSNLNTHMVVHSKEKPFKCEICSYTCGQKSSLNRHIMLVHSKEKPFKCEICSYTCGLKSSLNRHMLVHSKEKPFKCEICSHTFGQKSNLNTHMVVHSKETPFKCEICSHTFGQKSNLNTHMVVHSKEKPFKCEICSHTFGQKSNLNRHMLKHTK
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00057106;
- 90% Identity
- iTF_00057106;
- 80% Identity
- iTF_00057106;