Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.034 2.7 8.2 0.0 21 47 6 32 4 37 0.86

2 6 0.0064 0.5 10.5 0.1 21 48 34 61 30 66 0.90

3 6 1.5 1.2e+02 2.9 0.2 21 44 63 86 61 90 0.77

4 6 0.056 4.5 7.5 0.0 21 44 91 114 88 118 0.90

5 6 0.052 4.1 7.6 0.0 21 47 119 145 116 150 0.85

6 6 0.0034 0.27 11.4 0.0 21 44 147 170 144 174 0.89

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.034	2.7	8.2	0.0	21	47	6	32	4	37	0.86
2	6	0.0064	0.5	10.5	0.1	21	48	34	61	30	66	0.90
3	6	1.5	1.2e+02	2.9	0.2	21	44	63	86	61	90	0.77
4	6	0.056	4.5	7.5	0.0	21	44	91	114	88	118	0.90
5	6	0.052	4.1	7.6	0.0	21	47	119	145	116	150	0.85
6	6	0.0034	0.27	11.4	0.0	21	44	147	170	144	174	0.89

Coding Sequence: ATGCTAATACATACTAAAGAAAAGCCATTTAAATGTGAAATTTGTTCACATACCTTTGGACAAAAATCAAATTTAAACACACATATGGTAGTACACTCTAAAGAAAAGCCATTTAAATGTGAAATTTGTTCATACACGTGTGGACAAAAATCAAGTTTAAATAGACATATTATGCTAGTACACTCTAAAGAAAAGCCATTTAAATGTGAAATTTGTTCATACACGTGTGGACTAAAATCAAGTTTAAATAGACATATGCTAGTACACTCTAAAGAAAAGCCATTTAAATGTGAAATTTGTTCACATACCTTTGGACAAAAATCAAATTTAAACACACATATGGTAGTACACTCTAAAGAAACGCCATTTAAATGTGAAATTTGTTCACATACCTTTGGACAAAAATCAAATTTAAACACACATATGGTAGTACACTCTAAAGAAAAGCCATTTAAATGTGAAATTTGTTCACATACCTTTGGACAAAAATCAAATTTAAACAGACATATGCTAAAACACACTAAATAA
Protein Sequence: MLIHTKEKPFKCEICSHTFGQKSNLNTHMVVHSKEKPFKCEICSYTCGQKSSLNRHIMLVHSKEKPFKCEICSYTCGLKSSLNRHMLVHSKEKPFKCEICSHTFGQKSNLNTHMVVHSKETPFKCEICSHTFGQKSNLNTHMVVHSKEKPFKCEICSHTFGQKSNLNRHMLKHTK

Sequence clustering based on sequence similarity using MMseqs2