Aips020058.1
Basic Information
- Insect
- Agrotis ipsilon
- Gene Symbol
- -
- Assembly
- GCA_028554685.1
- Location
- CM052974.1:7842649-7842957[+]
Transcription Factor Domain
- TF Family
- HTH
- Domain
- HTH_psq domain
- PFAM
- PF05225
- TF Group
- Helix-turn-helix
- Description
- This DNA-binding motif is found in four copies in the pipsqueak protein of Drosophila melanogaster [1]. In pipsqueak this domain binds to GAGA sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 2.9 3.7e+03 -1.3 0.1 35 44 3 12 2 12 0.84 2 2 9.3e-13 1.2e-09 38.7 0.0 3 39 16 53 14 56 0.91
Sequence Information
- Coding Sequence
- ATGCCACGACGCTACCAAAGGAAGACTGAGACCAAATACAAATTAGAAGATTTAGAAAAAGCCGTTCACGATGTAAGGAACAAAATACTGTCGTTAGGAAAGGCatctattatttattctgttCCAAAAAGTACTATACATGACTATCtcaagaaagaaataataaatgaacCTAAAACTGGAAGAAAAGCTATATTTACTGATGCACAAGAAACTGAATTAGAACAACATATAATTAAATGCAGCAAAGTATTTTATGGCTTAACAATAGAAATGGTGCGAAAAATAGCTTTTAAATTTGCAAAATGA
- Protein Sequence
- MPRRYQRKTETKYKLEDLEKAVHDVRNKILSLGKASIIYSVPKSTIHDYLKKEIINEPKTGRKAIFTDAQETELEQHIIKCSKVFYGLTIEMVRKIAFKFAK
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01361518;
- 90% Identity
- iTF_01361518; iTF_01361530;
- 80% Identity
- -